STAT3 Protein, Human (His)
Based on 1 Customer Validation
STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His) is the recombinant human-derived STAT3 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His) is the recombinant human-derived STAT3 protein, expressed by E. coli , with C-6*His labeled tag.
STAT3, a signal transducer and transcription activator, orchestrates cellular responses to various growth factors, interleukins, and cytokines. Upon activation, STAT3 recruits coactivators to the promoter region of target genes, thereby mediating diverse cellular processes such as proliferation, differentiation, and immune response regulation. It responds to signaling from interleukin-6, KITLG/SCF, and other growth factors, facilitating a cascade of downstream events. Additionally, STAT3 plays a role in cell cycle regulation, inflammatory response modulation, and energy homeostasis. Its functions extend to influencing apoptosis, melanocortin production, and insulin secretion. The protein's activation involves homodimerization or heterodimerization with related family members. STAT3 interacts with an array of molecules, including IL31RA, NCOA1, PELP1, SIPAR, SOCS7, STATIP1, and others, contributing to its intricate involvement in cellular signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P40763-1 (M1-N175)
-
Molecular Construction
-
N-term
-
STAT3 (M1-N175)
Accession # P40763-1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
STAT3; Signal Transducer And Activator Of Transcription; Signal Transducer And Activator Of Transcription 3; DNA-Binding Protein APRF; APRF; ADMIO1; Acute-Phase Response Factor; ADMIO; Signal Transducer And Activator Of Transcription 3 (Acute-Phase Respon
-
AA Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFN
-
Predicted Molecular Mass
21.8 kDa
-
Molecular Weight
Approximately 19 kDa & 46 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 20mM Tris-HCl, 10% Trehalose, 50mM NaCl, 0.05% Tween 80, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
