SUMO1 Protein, Human (His)
Based on 1 Customer Validation
SUMO1 Protein is a member of the SUMO (small ubiquitin-like modifier) protein family. SUMO1 binds to target proteins as part of a post-translational modification system. It is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. SUMO1 also regulates the function of several proteins via non-covalent interactions. SUMO1 Protein, Human (His) is the recombinant human-derived SUMO1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SUMO1 Protein is a member of the SUMO (small ubiquitin-like modifier) protein family. SUMO1 binds to target proteins as part of a post-translational modification system. It is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. SUMO1 also regulates the function of several proteins via non-covalent interactions. SUMO1 Protein, Human (His) is the recombinant human-derived SUMO1 protein, expressed by E. coli , with N-6*His labeled tag.
Background
Small ubiquitin-related modifier 1 (SUMO1) is an ubiquitin-like protein that is a member of the SUMO protein family. SUMO1 binds to target proteins as part of a post-translational modification system. It is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. And it is not active until the last four amino acids of the carboxy-terminus have been cleaved off. SUMO1 also regulates the function of several proteins via non-covalent interactions involving the hydrophobic patch in the target protein identified as SUMO Binding or Interacting Motif (SBM/SIM). SUMO1 hinders α-Synuclein fibrillation by inducing structural compaction. SUMO1 acts as a signal for proteasomal degradation of modified proteins, and regulates a network of genes involved in palate development. It is also critical for post-infarction heart repair and that deletion of the SUMO1 gene aggravated myocardial injury after myocardial infarction (MI)[1][2][3][4].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized SUMO1 at 2 μg/mL (100 μL/well) can bind SUMO1 Antibody (HY-P80351).The ED50 for this effect is 3.853 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
AAH66306 (M1-V101)
-
Molecular Construction
-
N-term
-
6*His
-
SUMO1 (M1-V101)
Accession # AAH66306 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SUMO1; SMT3 Homolog 3; Prev. UBL1; SMT3 Suppressor Of Mif Two 3 Homolog 1 (Yeast), Isoform CRA_b; SMT3H3; SMT3 Suppressor Of Mif Two 3 Homolog 1 (S. Cerevisiae); SMT3C; SMT3 Suppressor Of Mif Two 3 Homolog 1 (Yeast); GMP1; SMT3 Suppressor Of Mif Two 3 Hom
-
AA Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNNTPKELGMEEEDVIEVYQEQTGGHSTV
-
Predicted Molecular Mass
13.7 kDa
-
Molecular Weight
Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, pH 8.5 .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)