Copy Link Print Information

Tetranectin/CLEC3B Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Tetranectin/CLEC3B protein exhibits binding to plasminogen and isolated kringle 4, suggesting potential roles in exocytosis-related molecule packaging and ocular physiology. Its homotrimeric structure emphasizes a propensity for trimeric complexes, highlighting the multifaceted nature of Tetranectin/CLEC3B in diverse molecular interactions and cellular processes. Tetranectin/CLEC3B Protein, Human (HEK293, His) is the recombinant human-derived Tetranectin/CLEC3B protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Tetranectin/CLEC3B Protein, Human (HEK293, His)
  • Experimental Validation Results for Tetranectin/CLEC3B Protein, Human (HEK293, His)
  • Tetranectin/CLEC3B Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Tetranectin/CLEC3B protein exhibits binding to plasminogen and isolated kringle 4, suggesting potential roles in exocytosis-related molecule packaging and ocular physiology. Its homotrimeric structure emphasizes a propensity for trimeric complexes, highlighting the multifaceted nature of Tetranectin/CLEC3B in diverse molecular interactions and cellular processes. Tetranectin/CLEC3B Protein, Human (HEK293, His) is the recombinant human-derived Tetranectin/CLEC3B protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Tetranectin/CLEC3B protein demonstrates binding capabilities to plasminogen and isolated kringle 4. It is implicated in potential roles related to the packaging of molecules designated for exocytosis, suggesting a function in cellular secretion processes. Additionally, Tetranectin/CLEC3B plays a role in retinal function, indicating its involvement in ocular physiology. Structurally, it forms homotrimers, emphasizing its tendency to exist as trimeric complexes. The diverse binding capacities and proposed functions underscore the multifaceted nature of Tetranectin/CLEC3B, implicating its involvement in various molecular interactions and cellular processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human HGF (HY-P70627) at 5 μg/mL (100 μL/well) can bind Biotinylated Human CLEC3B. The ED50 for this effect is 4.903 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human HGF (HY-P70627) at 5 μg/mL (100 μL/well) can bind Biotinylated Human CLEC3B. The ED50 for this effect is 4.903 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    AAH11024.1 (E22-V202)

  • Gene ID
    7123  [NCBI]
  • Molecular Construction
    • N-term
    • CLEC3B (E22-V202)
      Accession # AAH11024.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Tetranectin Chain

  • Synonyms

    CLEC3B; Tetranectin; Prev. TNA; Tetranectin (Plasminogen-Binding Protein); TN; C-Type Lectin Domain Family 3, Member B; Plasminogen Kringle 4-Binding Protein; MCDR4; C-Type Lectin Domain Family 3 Member B; Tetranectin (Plasminogen Binding Protein)

  • AA Sequence

    EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

  • Predicted Molecular Mass

    21 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human HGF (HY-P70627) at 5 μg/mL (100 μL/well) can bind Biotinylated Human CLEC3B. The ED50 for this effect is 4.903 μg/mL.

  • Tetranectin/CLEC3B Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Tetranectin/CLEC3B Protein, Human (HEK293, His)
  • Experimental Validation Results for Tetranectin/CLEC3B Protein, Human (HEK293, His)
  • Tetranectin/CLEC3B Protein, Human (HEK293, His) Product Image