TFPI Protein, Human (Biotinylated, HEK293, His-Avi)
TFPI (Tissue Factor Pathway Inhibitor) directly inhibits factor X (Xa) and inhibits the activity of VIIa/tissue factor through an Xa-dependent mechanism. It potentially forms a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. TFPI exhibits antithrombotic properties and can associate with lipoproteins, demonstrating its multifaceted role in regulating the coagulation pathway. TFPI Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TFPI (Tissue Factor Pathway Inhibitor) directly inhibits factor X (Xa) and inhibits the activity of VIIa/tissue factor through an Xa-dependent mechanism. It potentially forms a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. TFPI exhibits antithrombotic properties and can associate with lipoproteins, demonstrating its multifaceted role in regulating the coagulation pathway. TFPI Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
TFPI (Tissue Factor Pathway Inhibitor) directly inhibits factor X (Xa) and, in an Xa-dependent manner, inhibits the activity of VIIa/tissue factor, possibly by forming a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. This protein exhibits antithrombotic properties and has the capacity to associate with lipoproteins in plasma, showcasing its multifaceted role in regulating the coagulation pathway.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P10646 (D29-K282)
-
Molecular Construction
-
N-term
-
TFPI (D29-K282)
Accession # P10646 -
8*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
TFPI; EPI; Prev. LACI; Tissue Factor Pathway Inhibitor (Lipoprotein-Associated Coagulation Inhibitor); Extrinsic Pathway Inhibitor; Lipoprotein-Associated Coagulation Inhibitor; TFPI1; Anti-Convertin; Tissue Factor Pathway Inhibitor; TFI
-
AA Sequence
DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
-
Predicted Molecular Mass
32.1 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
