TFPI Protein, Human (Biotinylated, HEK293, His)

TFPI (Tissue Factor Pathway Inhibitor) directly inhibits factor X (Xa) and inhibits the activity of VIIa/tissue factor through an Xa-dependent mechanism. It potentially forms a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. TFPI exhibits antithrombotic properties and can associate with lipoproteins, demonstrating its multifaceted role in regulating the coagulation pathway. TFPI Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-His labeled tag.

TFPI (Tissue Factor Pathway Inhibitor) directly inhibits factor X (Xa) and, in an Xa-dependent manner, inhibits the activity of VIIa/tissue factor, possibly by forming a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. This protein exhibits antithrombotic properties and has the capacity to associate with lipoproteins in plasma, showcasing its multifaceted role in regulating the coagulation pathway.

Human

HEK293

C-His

P10646 (D29-K282)

7035  [NCBI]

Partial

Biotin

The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.

DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of Sterile PBS.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.