TFPI Protein, Human (Biotinylated, HEK293, His)
TFPI (Tissue Factor Pathway Inhibitor) directly inhibits factor X (Xa) and inhibits the activity of VIIa/tissue factor through an Xa-dependent mechanism. It potentially forms a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. TFPI exhibits antithrombotic properties and can associate with lipoproteins, demonstrating its multifaceted role in regulating the coagulation pathway. TFPI Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TFPI (Tissue Factor Pathway Inhibitor) directly inhibits factor X (Xa) and inhibits the activity of VIIa/tissue factor through an Xa-dependent mechanism. It potentially forms a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. TFPI exhibits antithrombotic properties and can associate with lipoproteins, demonstrating its multifaceted role in regulating the coagulation pathway. TFPI Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-His labeled tag.
Background
TFPI (Tissue Factor Pathway Inhibitor) directly inhibits factor X (Xa) and, in an Xa-dependent manner, inhibits the activity of VIIa/tissue factor, possibly by forming a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. This protein exhibits antithrombotic properties and has the capacity to associate with lipoproteins in plasma, showcasing its multifaceted role in regulating the coagulation pathway.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P10646 (D29-K282)
-
Molecular Construction
-
N-term
-
TFPI (D29-K282)
Accession # P10646 -
His
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Conjugate Method
The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.
-
Synonyms
TFPI; EPI; Prev. LACI; Tissue Factor Pathway Inhibitor (Lipoprotein-Associated Coagulation Inhibitor); Extrinsic Pathway Inhibitor; Lipoprotein-Associated Coagulation Inhibitor; TFPI1; Anti-Convertin; Tissue Factor Pathway Inhibitor; TFI
-
AA Sequence
DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
-
Predicted Molecular Mass
30.6 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
