TGFBR2/TGF-beta RII Protein, Human (HEK293, mFc-Avi)
Based on 1 publication(s) in Google Scholar
The TGFBR2/TGF-β RII protein cooperates with TGFBR1 to form dedicated receptors for TGFB1, TGFB2, and TGFB3. It serves as a signal transducer that coordinates diverse physiological and pathological processes, including cell cycle regulation, mesenchymal cell dynamics, wound healing, matrix production, immunosuppression, and carcinogenesis. TGFBR2/TGF-beta RII Protein, Human (HEK293, mFc-Avi) is the recombinant human-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The TGFBR2/TGF-β RII protein cooperates with TGFBR1 to form dedicated receptors for TGFB1, TGFB2, and TGFB3. It serves as a signal transducer that coordinates diverse physiological and pathological processes, including cell cycle regulation, mesenchymal cell dynamics, wound healing, matrix production, immunosuppression, and carcinogenesis. TGFBR2/TGF-beta RII Protein, Human (HEK293, mFc-Avi) is the recombinant human-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.
Background
The transmembrane serine/threonine kinase, TGFBR2 (TGF-beta RII), collaborates with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, to form the dedicated receptor for TGF-beta cytokines, including TGFB1, TGFB2, and TGFB3. Functioning as a signal transducer, TGFBR2 mediates the transmission of TGFB1, TGFB2, and TGFB3 signals from the cell surface to the cytoplasm, thereby orchestrating a diverse array of physiological and pathological processes. These include cell cycle arrest in epithelial and hematopoietic cells, regulation of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. The receptor complex, comprising 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer, leads to the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 subsequently phosphorylates SMAD2, causing its dissociation from the receptor and interaction with SMAD4. The resulting SMAD2-SMAD4 complex translocates to the nucleus, where it modulates the transcription of TGF-beta-regulated genes, constituting the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 participates in non-canonical, SMAD-independent TGF-beta signaling pathways and exhibits transforming growth factor beta-activated receptor activity.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Immobilized Human Mature TGF beta 1, No Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Human TGF-beta RII, mFc Tag with the EC50 of 8 ng/mL determined by ELISA.
3.Immobilized Human TGF-beta RII, mFc Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human Mature TGF beta 3, Avi Tag with the EC50 of 14.6 ng/mL determined by ELISA.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Membranes
Binding Behavior between Transforming-Growth-Factor-Beta1 and Its Receptor Reconstituted in Biomimetic Membranes. [Abstract]2023 Apr 19;13(4):446. PMID: 37103873
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-mFc
-
Accession
P37173-1 (I24-D159)
-
Molecular Construction
-
N-term
-
TGFBR2 (I24-D159)
Accession # P37173-1 -
mFc-Avi
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TGFBR2; Transforming Growth Factor, Beta Receptor II Gamma; Prev. MFS2; Transforming Growth Factor, Beta Receptor II Beta; TGF-Beta Type II Receptor; Serine/Threonine-Protein Kinase Receptor; TGF-Beta Receptor Type-2; Receptor Protein Serine/Threonine Kin
-
AA Sequence
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
-
Predicted Molecular Mass
44 kDa
-
Molecular Weight
Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)