1. Recombinant Proteins
  2. TNF-alpha Protein, Bovine

TNF-alpha Protein, Bovine

Cat. No.: HY-P7302
Handling Instructions

TNF-alpha Protein, Bovine is a cytokine involved in systemic inflammation and is one of the cytokines that make up the acute phase reaction.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rBoTNF-α; Cachectin; TNFA; TNF-α
Species

Bovine

Source

E. coli

Accession

Q06599 (L78-L234)

Gene ID

280943

Molecular Weight

Approximately 17.6 kDa

AA Sequence

MLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL

Biological Activity
The ED50 is <0.1 μg/mL as measured by mouse L-929 cells, corresponding to a specific activity of >1.0 × 104 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Tumor Necrosis Factor alpha is a cytokine involved in systemic inflammation and is one of the cytokines that make up the acute phase reaction. Bovine tumor necrosis factor-α alters luteal cell synthetic capacity and viability[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-alpha Protein, Bovine
Cat. No.:
HY-P7302
Quantity:
MCE Japan Authorized Agent: