TNF RI/TNFRSF1A Protein, Human (HEK293, His)
Based on 1 Customer Validation
The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, His) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-8*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, His) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-8*His labeled tag.
Background
TNFRSF1A (TNF RI) protein is a single-pass type I membrane protein belonging to the tumor necrosis factor (TNF) family. TNFRSF1A is the major signaling receptor for TNF-α. TNFRSF1A protein is a multifunctional cytokine, which is synthesized by almost all cells[1][2].
The sequence of amino acids in TNFRSF1A from different species is very different (less than 85% similarity among human, rat and mouse).
TNFRSF1A contains a protein-protein interaction domain, called death domain (DD), can recruit other DD-containing proteins and couples the death receptors to caspase activation and apoptosis. Both soluble and membrane-bound forms of the cytokine can activate TNFRSF1A. TNFRSF1A induces cellular inflammatory damage and apoptosis by participating in mTOR, JNK, IKK, caspase 3, MAPK, and NF-κB pathways[1][3][4].
Verified Bioactivity
1.Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D. The EC50 for this effect is ≤0.06164 μg/mLin the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is ≥1.622×104 units/mg.
2.Immobilized TNF-α, Human at 10 μg/mL (100 μL/well) can bind TNFR-1/CD120a His Tag, Human with EC50 of 0.1-0.2 μg/mL.
3.Anti-His antibody Immobilized on CM5 Chip captured TNFR-1/CD120a His Tag, Human, can bind TNF-α, Human with an affinity constant of 0.106 nM as determined in SPR assay.
MCE Validation Data
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
P19438-1 (L30-T211)
-
Molecular Construction
-
N-term
-
TNFR-1 (L30-T211)
Accession # P19438-1 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFRSF1A; Tumor Necrosis Factor Receptor 1; Prev. TNFR1; TNF-RI; TNFAR; TNFR-I; Tumor Necrosis Factor Receptor Superfamily Member 1A; Tumor Necrosis Factor Receptor Superfamily, Member 1A; TNF-R-I; Tumor Necrosis Factor Binding Protein 1; TNF-R55; Tumor N
-
AA Sequence
LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
-
Predicted Molecular Mass
21.6 kDa
-
Molecular Weight
Approximately 28-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<0.1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
