TRIB2 Protein, Human (sf9, His-GST)
TRIB2 protein regulates MAP kinase activation by interacting with MAPK kinase, acting as a regulator without intrinsic kinase activity. Emphasizing its role in fine-tuning the MAP kinase signaling pathway. TRIB2 Protein, Human (sf9, His-GST) is the recombinant human-derived TRIB2 protein, expressed by Sf9 insect cells , with C-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TRIB2 protein regulates MAP kinase activation by interacting with MAPK kinase, acting as a regulator without intrinsic kinase activity. Emphasizing its role in fine-tuning the MAP kinase signaling pathway. TRIB2 Protein, Human (sf9, His-GST) is the recombinant human-derived TRIB2 protein, expressed by Sf9 insect cells , with C-His, N-GST labeled tag.
Background
The TRIB2 protein exerts regulatory control over the activation of MAP kinases by interacting with MAPK kinases, despite lacking intrinsic kinase activity itself. This interaction underscores TRIB2's role as a modulator rather than a direct kinase, suggesting its involvement in fine-tuning MAP kinase signaling pathways. Additionally, TRIB2 engages in a specific interaction with COP1, further expanding its potential regulatory influence within cellular processes. The functional implications of these interactions highlight TRIB2 as a key player in orchestrating cellular signaling cascades and warrant further exploration into its intricate regulatory mechanisms.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His;N-GST
-
Accession
Q92519 (M1-N343)
-
Molecular Construction
-
N-term
-
GST
-
TRIB2 (M1-N343)
Accession # Q92519 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
TRIB2; TRB2; Tribbles homolog 2; TRB-2; C5FW; Tribbles Homolog 2 (Drosophila); Tribbles Pseudokinase 2; GS3955
-
AA Sequence
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
-
Predicted Molecular Mass
66 kDa
-
Molecular Weight
Approximately 66 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
