1. Recombinant Proteins
  2. Kinases
  3. CAMK Pseudokinases
  4. Trbl
  5. TRIB1/Trb1
  6. TRIB2 Protein, Human (sf9, His-GST)

TRIB2 protein regulates MAP kinase activation by interacting with MAPK kinase, acting as a regulator without intrinsic kinase activity. Emphasizing its role in fine-tuning the MAP kinase signaling pathway. TRIB2 Protein, Human (sf9, His-GST) is the recombinant human-derived TRIB2 protein, expressed by Sf9 insect cells , with C-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRIB2 protein regulates MAP kinase activation by interacting with MAPK kinase, acting as a regulator without intrinsic kinase activity. Emphasizing its role in fine-tuning the MAP kinase signaling pathway. TRIB2 Protein, Human (sf9, His-GST) is the recombinant human-derived TRIB2 protein, expressed by Sf9 insect cells , with C-His, N-GST labeled tag.

Background

The TRIB2 protein exerts regulatory control over the activation of MAP kinases by interacting with MAPK kinases, despite lacking intrinsic kinase activity itself. This interaction underscores TRIB2's role as a modulator rather than a direct kinase, suggesting its involvement in fine-tuning MAP kinase signaling pathways. Additionally, TRIB2 engages in a specific interaction with COP1, further expanding its potential regulatory influence within cellular processes. The functional implications of these interactions highlight TRIB2 as a key player in orchestrating cellular signaling cascades and warrant further exploration into its intricate regulatory mechanisms.

Species

Human

Source

Sf9 insect cells

Tag

C-His;N-GST

Accession

Q92519 (M1-N343)

Gene ID
Molecular Construction
N-term
GST
TRIB2 (M1-N343)
Accession # Q92519
His
C-term
Protein Length

Full Length

Synonyms
Tribbles homolog 2; TRB-2; TRIB2; TRB2
AA Sequence

MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

Predicted Molecular Mass
66 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TRIB2 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TRIB2 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRIB2 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P74492
Quantity:
MCE Japan Authorized Agent: