1. Recombinant Proteins
  2. Receptor Proteins
  3. TSLP R Protein, Cynomolgus (HEK293, His)

TSLP R protein is the receptor of TSLP and cooperates with IL7R to form a complex that activates STAT3 and STAT5 to stimulate cell proliferation. This receptor also activates JAK2, which is critical for the development of the hematopoietic system. TSLP R Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TSLP R protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

TSLP R protein is the receptor of TSLP and cooperates with IL7R to form a complex that activates STAT3 and STAT5 to stimulate cell proliferation. This receptor also activates JAK2, which is critical for the development of the hematopoietic system. TSLP R Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TSLP R protein, expressed by HEK293 , with C-His labeled tag.

Background

The TSLPR Protein functions as the receptor for thymic stromal lymphopoietin (TSLP) and, in collaboration with IL7R, forms a functional complex that stimulates cell proliferation through the activation of STAT3 and STAT5. Additionally, the receptor activates JAK2 and plays a crucial role in the development of the hematopoietic system. The TSLPR receptor, existing as a heterodimer of CRLF2 and IL7R, is an essential component of the high-affinity ternary complex, where the binding of TSLP to CRLF2/TSLPR is a mechanistic prerequisite for the recruitment of IL7R, highlighting its pivotal role in intricate signaling pathways critical for cellular responses and hematopoietic development.

Biological Activity

1. Immobilized Cynomolgus TSLPR, His Tag at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-TSLPR Antibody, hFc Tag with the EC50 of <13.3 ng/mL determined by ELISA.
2. Immobilized Cynomolgus TSLPR, His Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Cynomolgus TSLP, His Tag with the EC50 of 0.09-0.17 μg/ml determined by ELISA.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

XP_045239630.1 (Q23-K231)

Gene ID
Molecular Construction
N-term
TSLP R (Q23-K231)
Accession # XP_045239630.1
8*His
C-term
Protein Length

Partial

Synonyms
TSLP receptor; TSLPR; CRL2; CRLF2Y; CRLF2; IL-XR; p2RY8/CRLF2 fusion; CRLF2
AA Sequence

QVATGEGLQIQIMYFNLETVQVTWNASHYPRSNLSFHYKFSRDEAYDQCTVYILQEGHTSGCLLDAQQQDDILYFSIRNGTHPVFTASRWIFYYLKPSSPKQVSFSWHQDAVTLTCSDLSYRGLLYEVQYRSPFDTEWQSKQENTCNVTIEDLDAEKCYAFRARVKAMEDAYGPDTYPSDWSEVTCWQRGKTRDSCPEPRTPPKPKLSK

분자량

Approximately 42-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

TSLP R Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TSLP R Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TSLP R Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700842
수량:
MCE Japan Authorized Agent: