TSLP Receptor Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
TSLP Receptor protein is the receptor of TSLP and cooperates with IL7R to form a complex that activates STAT3 and STAT5 to stimulate cell proliferation. This receptor also activates JAK2, which is critical for the development of the hematopoietic system. TSLP Receptor Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TSLP Receptor protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TSLP Receptor protein is the receptor of TSLP and cooperates with IL7R to form a complex that activates STAT3 and STAT5 to stimulate cell proliferation. This receptor also activates JAK2, which is critical for the development of the hematopoietic system. TSLP Receptor Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TSLP Receptor protein, expressed by HEK293 , with C-His labeled tag.
Background
The TSLPR Protein functions as the receptor for thymic stromal lymphopoietin (TSLP) and, in collaboration with IL7R, forms a functional complex that stimulates cell proliferation through the activation of STAT3 and STAT5. Additionally, the receptor activates JAK2 and plays a crucial role in the development of the hematopoietic system. The TSLPR receptor, existing as a heterodimer of CRLF2 and IL7R, is an essential component of the high-affinity ternary complex, where the binding of TSLP to CRLF2/TSLPR is a mechanistic prerequisite for the recruitment of IL7R, highlighting its pivotal role in intricate signaling pathways critical for cellular responses and hematopoietic development.
Verified Bioactivity
1. Immobilized Cynomolgus TSLPR, His Tag at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-TSLPR Antibody, hFc Tag with the EC50 of <13.3 ng/mL determined by ELISA.
2. Immobilized Cynomolgus TSLPR, His Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Cynomolgus TSLP, His Tag with the EC50 of 0.09-0.17 μg/ml determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
XP_045239630.1 (Q23-K231)
-
Molecular Construction
-
N-term
-
TSLP R (Q23-K231)
Accession # XP_045239630.1 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CRLF2; IL-XR; Cytokine Receptor Like Factor 2; Thymic Stromal-Derived Lymphopoietin Receptor; TSLPR; Cytokine Receptor CRL2 Precusor; CRL2; Cytokine Receptor-Like 2; Thymic Stromal Lymphopoietin Protein Receptor; CRLF2Y; Cytokine Receptor-Like Factor 2; P
-
AA Sequence
QVATGEGLQIQIMYFNLETVQVTWNASHYPRSNLSFHYKFSRDEAYDQCTVYILQEGHTSGCLLDAQQQDDILYFSIRNGTHPVFTASRWIFYYLKPSSPKQVSFSWHQDAVTLTCSDLSYRGLLYEVQYRSPFDTEWQSKQENTCNVTIEDLDAEKCYAFRARVKAMEDAYGPDTYPSDWSEVTCWQRGKTRDSCPEPRTPPKPKLSK
-
Predicted Molecular Mass
25.4 kDa
-
Molecular Weight
Approximately 42-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
