TSPAN8 Protein, Human (HEK293, Fc)

TSPAN8 is a cell surface glycoprotein that is complexed with integrins and belongs to the four-span protein family. It has four hydrophobic domains. TSPAN8 mediates extracellular signal transduction processes and regulates cell development, activation, growth, and movement. In addition, TSPAN8 is expressed in different cancers and has potential roles in cancer prognosis and targeted therapy. TSPAN8 Protein, Human (HEK293, Fc) is the recombinant human-derived TSPAN8 protein, expressed by HEK293 , with N-mFc labeled tag.

TSPAN8 plays an important role in promoting tumor metastasis by activating the EGFR/AKT pathway^[1].
TSPAN8 alleviates high-glucose-induced autophagy and apoptosis in HK-2 cells by targeting mTORC2^[2].
TSPAN8 forms protein complexes mediated by TSPAN8 through interactions with itself and various other cell signaling molecules. These protein complexes help to construct tetraspan-rich microdomains (TEMs), which effectively mediate intracellular signaling transduction. In addition, TSPAN8 plays a crucial role in regulating biological functions such as leukocyte migration, angiogenesis, and wound repair^[3].

Human

HEK293

N-mFc

P19075 (K110-N205)

7103  [NCBI]

Partial

KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN

Approximately 46 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.