TSPAN8 Protein, Human (HEK293, Fc)
TSPAN8 is a cell surface glycoprotein that is complexed with integrins and belongs to the four-span protein family. It has four hydrophobic domains. TSPAN8 mediates extracellular signal transduction processes and regulates cell development, activation, growth, and movement. In addition, TSPAN8 is expressed in different cancers and has potential roles in cancer prognosis and targeted therapy. TSPAN8 Protein, Human (HEK293, Fc) is the recombinant human-derived TSPAN8 protein, expressed by HEK293 , with N-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TSPAN8 is a cell surface glycoprotein that is complexed with integrins and belongs to the four-span protein family. It has four hydrophobic domains. TSPAN8 mediates extracellular signal transduction processes and regulates cell development, activation, growth, and movement. In addition, TSPAN8 is expressed in different cancers and has potential roles in cancer prognosis and targeted therapy. TSPAN8 Protein, Human (HEK293, Fc) is the recombinant human-derived TSPAN8 protein, expressed by HEK293 , with N-mFc labeled tag.
Background
TSPAN8 plays an important role in promoting tumor metastasis by activating the EGFR/AKT pathway[1].
TSPAN8 alleviates high-glucose-induced autophagy and apoptosis in HK-2 cells by targeting mTORC2[2].
TSPAN8 forms protein complexes mediated by TSPAN8 through interactions with itself and various other cell signaling molecules. These protein complexes help to construct tetraspan-rich microdomains (TEMs), which effectively mediate intracellular signaling transduction. In addition, TSPAN8 plays a crucial role in regulating biological functions such as leukocyte migration, angiogenesis, and wound repair[3].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-mFc
-
Accession
P19075 (K110-N205)
-
Molecular Construction
-
N-term
-
mFc
-
TSPAN8 (K110-N205)
Accession # P19075 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Tspan8; Tetraspanin-8; Tspan-8; TM4SF3; TSPAN8; Tumor-associated antigen CO-029; Transmembrane 4 superfamily member 3; CO-029
-
AA Sequence
KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN
-
Predicted Molecular Mass
37.6 kDa
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
