Copy Link Print Information

UNC5B Protein, Rat (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

UNC5B is a netrin-1-dependent receptor. It negatively regulates vascular branching during angiogenesis. In addition, UNC5B protects myelin and partially alleviates injury-induced neuropathic pain (NP). UNC5B is involved in the guidance of axons and the positive regulation of exogenous apoptosis signaling pathways without binding to netrin-1. UNC5B Protein, Rat (HEK293, Fc) is the recombinant rat-derived UNC5B protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • UNC5B Protein, Rat (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

UNC5B is a netrin-1-dependent receptor. It negatively regulates vascular branching during angiogenesis. In addition, UNC5B protects myelin and partially alleviates injury-induced neuropathic pain (NP). UNC5B is involved in the guidance of axons and the positive regulation of exogenous apoptosis signaling pathways without binding to netrin-1. UNC5B Protein, Rat (HEK293, Fc) is the recombinant rat-derived UNC5B protein, expressed by HEK293 , with C-hFc labeled tag.

Background

UNC5B promotes autophagic flux in Schwann cells (SCs) through phosphorylation of AMPK and ULK1, depending on its ligand netrin-1, protecting myelin and partially preventing injury-induced neuropathic pain (NP)[1].
UNC5B also plays a role in axon guidance and positively regulates exogenous apoptosis signaling pathways without binding to netrin-1[2].
The activation of UNC5B inhibits sprouting angiogenesis, making it a potential anti-angiogenic target[3].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized UNC5B at 5 µg/mL (100 µL/well) can bind rmNetrin-1. The ED50 for this effect is 218.2 ng/mL

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-hFc
  • Accession

    O08722/NP_071543.1 (G27-D373)

  • Gene ID
    60630  [NCBI]
  • Molecular Construction
    • N-term
    • UNC5B (G27-D373)
      Accession # O08722/NP_071543.1
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    UNC5B; Unc-5 Netrin Receptor B; P53RDL1; UNC5H2; P53-Regulated Receptor For Death And Life Protein 1; Protein Unc-5 Homolog 2; Protein Unc-5 Homolog B; Netrin Receptor UNC5B; Transmembrane Receptor Unc5H2; Unc-5 Homolog B (C. Elegans); Unc5 (C.Elegans Hom

  • AA Sequence

    GIDSGGQALPDSFPSAPAEQLPHFLLEPEDAYIVKNKPVELHCRAFPATQIYFKCNGEWVSQKGHVTQESLDEATGLRIREVQIEVSRQQVEELFGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQACQKTACTTVCPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVLNQRTLNDPKSRPLEPSGD

  • Predicted Molecular Mass

    64.8 kDa

  • Molecular Weight

    Approximately 90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • UNC5B Protein, Rat (HEK293, Fc) Product Image
    1/16
  • UNC5B Protein, Rat (HEK293, Fc) Product Image