1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLAU/uPA Protein, Human (HEK293, His)

uPA chain A Protein, a key player in the plasminogen activation system, selectively cleaves plasminogen, initiating fibrinolysis and contributing to tissue remodeling. Its precision underscores its role in regulating proteolytic activity, emphasizing its significance in the cascade of events leading to fibrinolysis and extracellular matrix remodeling in various physiological processes. PLAU/uPA Protein, Human (HEK293, His) is the recombinant human-derived PLAU/uPA protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

uPA chain A Protein, a key player in the plasminogen activation system, selectively cleaves plasminogen, initiating fibrinolysis and contributing to tissue remodeling. Its precision underscores its role in regulating proteolytic activity, emphasizing its significance in the cascade of events leading to fibrinolysis and extracellular matrix remodeling in various physiological processes. PLAU/uPA Protein, Human (HEK293, His) is the recombinant human-derived PLAU/uPA protein, expressed by HEK293 , with C-His labeled tag.

Background

uPA chain A, a key player in the plasminogen activation system, performs a critical role as it selectively cleaves the zymogen plasminogen to generate the enzymatically active form known as plasmin. This proteolytic activation is a pivotal step in fibrinolysis, where plasmin functions to degrade fibrin clots and contribute to tissue remodeling and repair. uPA chain A's precision in cleaving plasminogen underscores its significance in regulating the delicate balance of proteolytic activity, emphasizing its role as a key initiator in the cascade of events leading to fibrinolysis and other physiological processes involving extracellular matrix remodeling.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized human uPA at 5 μg/ml (100 μl/well) can bind mouse PLAUR with a linear range of 1.6-40 ng/ml.

Species

Human

Source

HEK293

Tag

C-His

Accession

NP_002649.1 (S21-L431)

Gene ID
Molecular Construction
N-term
PLAU (S21-L431)
Accession # NP_002649.1
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Urokinase-type plasminogen activator; uPA; PLAU
AA Sequence

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Molecular Weight

Approximately 18&32&50 kDa

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PLAU/uPA Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PLAU/uPA Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLAU/uPA Protein, Human (HEK293, His)
Cat. No.:
HY-P73467
Quantity:
MCE Japan Authorized Agent: