VEGF-D Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

VEGF-D Protein, a versatile growth factor, orchestrates angiogenesis, lymphangiogenesis, and endothelial cell growth. It stimulates proliferation, migration, and influences vessel permeability. VEGF-D binds VEGFR-3, triggering crucial signaling for vascular development. Structurally, VEGF-D is a non-covalent homodimer, emphasizing its intricate role in vascular processes. VEGF-D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VEGF-D protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

VEGF-D Protein, a versatile growth factor, orchestrates angiogenesis, lymphangiogenesis, and endothelial cell growth. It stimulates proliferation, migration, and influences vessel permeability. VEGF-D binds VEGFR-3, triggering crucial signaling for vascular development. Structurally, VEGF-D is a non-covalent homodimer, emphasizing its intricate role in vascular processes. VEGF-D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VEGF-D protein, expressed by HEK293 , with N-hFc labeled tag.

Background

VEGF-DD, a versatile growth factor, plays a pivotal role in angiogenesis, lymphangiogenesis, and endothelial cell growth by orchestrating processes such as proliferation, migration, and influencing blood vessel permeability. Its involvement spans critical phases, contributing to the formation of both venous and lymphatic vascular systems during embryogenesis, and maintaining the integrity of differentiated lymphatic endothelium in adults. Functionally, VEGF-DD binds to and activates the VEGFR-3 (Flt4) receptor, initiating essential signaling cascades for vascular development and homeostasis. Structurally, VEGF-DD exists as a homodimer, characterized by a non-covalent and antiparallel configuration, underscoring its intricate role in coordinating complex vascular phenomena.

Verified Bioactivity

Measured by its ability to inhibit the proliferation of HUVEC cells. The ED50 for this effect is 0.3018 μg/mL, corresponding to a specific activity is 3.313×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the proliferation of HUVEC cells. The ED50 for this effect is 0.3018 μg/mL, corresponding to a specific activity is 3.313×104U/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • VEGF-DD (F98-S206)
      Accession # P97946
    • C-term
  • Protein Length

    Partial

  • Synonyms

    VEGFD; Vascular Endothelial Growth Factor D; FIGF; VEGF-D; C-Fos Induced Growth Factor (Vascular Endothelial Growth Factor D); C-Fos-Induced Growth Factor

  • AA Sequence

    FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYS

  • Predicted Molecular Mass

    38.2 kDa

  • Molecular Weight

    Approximately 45 kDa & 36 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Structure/Form

    homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00