VEGF-DD Protein, Mouse (HEK293, Fc)

VEGF-DD Protein, a versatile growth factor, orchestrates angiogenesis, lymphangiogenesis, and endothelial cell growth. It stimulates proliferation, migration, and influences vessel permeability. VEGF-DD binds VEGFR-3, triggering crucial signaling for vascular development. Structurally, VEGF-DD is a non-covalent homodimer, emphasizing its intricate role in vascular processes. VEGF-DD Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VEGF-DD protein, expressed by HEK293 , with N-hFc labeled tag. The total length of VEGF-DD Protein, Mouse (HEK293, Fc) is 109 a.a., with molecular weight of ~45 & 36 kDa, respectively.

VEGF-DD, a versatile growth factor, plays a pivotal role in angiogenesis, lymphangiogenesis, and endothelial cell growth by orchestrating processes such as proliferation, migration, and influencing blood vessel permeability. Its involvement spans critical phases, contributing to the formation of both venous and lymphatic vascular systems during embryogenesis, and maintaining the integrity of differentiated lymphatic endothelium in adults. Functionally, VEGF-DD binds to and activates the VEGFR-3 (Flt4) receptor, initiating essential signaling cascades for vascular development and homeostasis. Structurally, VEGF-DD exists as a homodimer, characterized by a non-covalent and antiparallel configuration, underscoring its intricate role in coordinating complex vascular phenomena.

Measured by its ability to inhibit the proliferation of HUVEC cells. The ED₅₀ for this effect is 0.3018 μg/mL, corresponding to a specific activity is 3.313×10⁴ U/mg.

• 
  Measured by its ability to inhibit the proliferation of HUVEC cells. The ED₅₀ for this effect is 0.3018 μg/mL, corresponding to a specific activity is 3.313×10⁴U/mg.

Mouse

HEK293

N-hFc

P97946 (F98-S206)

14205  [NCBI]

FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYS

Approximately 42-50 kDa, due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.