1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi)

VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78814
Handling Instructions Technical Support

VEGF-A Protein is a key member of the VEGF family of cytokines. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived VEGF164 protein, expressed by HEK293 , with N-His, N-Avi labeled tag. The total length of VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi) is 164 a.a., with molecular weight of 28-33 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

VEGF-A Protein is a key member of the VEGF family of cytokines. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived VEGF164 protein, expressed by HEK293 , with N-His, N-Avi labeled tag. The total length of VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi) is 164 a.a., with molecular weight of 28-33 kDa.

Background

VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PGF. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A binds to the FLT1/VEGFR1, KDR/VEGFR2 and DEAR/FBXW7-AS1 receptors, heparan sulfate and heparin. VEGF-A also binds to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF-A is also a vasodilator and increases microvascular permeability[1][2][3][4][5].

Biological Activity

Immobilized VEGFR1/R2 Fc at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse VEGF164 His-Avi with a linear range of 0.02-0.82 ng/mL.

Species

Mouse

Source

HEK293

Tag

N-His;N-Avi

Accession

Q00731-2 (A27-R190)

Gene ID
Protein Length

Full Length of VEGFA

Conjugation

Biotin

Synonyms
RP1-261G23.1; MGC70609; MVCD1; VEGFA; VPF
AA Sequence

APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Predicted Molecular Mass
22.5 kDa
Molecular Weight

Approximately 28-33 kDa under reduced (R) conditions, 46-60 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally 10% trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78814
Quantity:
MCE Japan Authorized Agent: