VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi)
VEGF-A Protein is a key member of the VEGF family of cytokines. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived VEGF164 protein, expressed by HEK293 , with N-His, N-Avi labeled tag. The total length of VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi) is 164 a.a., with molecular weight of 28-33 kDa.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
VEGF-A Protein is a key member of the VEGF family of cytokines. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived VEGF164 protein, expressed by HEK293 , with N-His, N-Avi labeled tag. The total length of VEGF164 Protein, Mouse (Biotinylated, HEK293, His-Avi) is 164 a.a., with molecular weight of 28-33 kDa.
Background
VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PGF. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A binds to the FLT1/VEGFR1, KDR/VEGFR2 and DEAR/FBXW7-AS1 receptors, heparan sulfate and heparin. VEGF-A also binds to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF-A is also a vasodilator and increases microvascular permeability[1][2][3][4][5].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His;N-Avi
-
Accession
Q00731-2 (A27-R190)
-
Protein Length
Full Length of Isoform-2
-
Conjugation
Biotin
-
Synonyms
VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G
-
AA Sequence
APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
-
Predicted Molecular Mass
22.5 kDa
-
Molecular Weight
Approximately 28-33 kDa under reduced (R) conditions, 46-60 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. He W, et al. CMT2D neuropathy is linked to the neomorphic binding activity of glycyl-tRNA synthetase. Nature. 2015 Oct 29;526(7575):710-4. [Content Brief]
[2]. Herrera VL, et al. Embryonic lethality in Dear gene-deficient mice: new player in angiogenesis. Physiol Genomics. 2005 Nov 17;23(3):257-68. [Content Brief]
[3]. Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25(1):1-19. [Content Brief]
[4]. Murphy JF, et al. Vascular endothelial growth factor induces cyclooxygenase-dependent proliferation of endothelial cells via the VEGF-2 receptor. FASEB J. 2001 Jul;15(9):1667-9. [Content Brief]
[5]. Dixelius J, et al. Minimal active domain and mechanism of action of the angiogenesis inhibitor histidine-rich glycoprotein. Cancer Res. 2006 Feb 15;66(4):2089-97. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)