1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi)

VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78229
COA Handling Instructions

VEGF145 Protein, with limited expression, exhibits specialized distribution and is not broadly present in tissues. Its restricted occurrence implies a specific, context-dependent role in physiological processes. Further research is needed to unveil the specific cellular contexts and functions where VEGF145 actively participates, providing insights into its potential contributions to localized biological activities. VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is 165 a.a., with molecular weight of 28-32 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $355 In-stock
50 μg $585 In-stock
100 μg $995 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VEGF145 Protein, with limited expression, exhibits specialized distribution and is not broadly present in tissues. Its restricted occurrence implies a specific, context-dependent role in physiological processes. Further research is needed to unveil the specific cellular contexts and functions where VEGF145 actively participates, providing insights into its potential contributions to localized biological activities. VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is 165 a.a., with molecular weight of 28-32 kDa.

Background

VEGF145 Protein, characterized by limited expression, is not widely distributed across tissues or cell types. The restricted occurrence of VEGF145 suggests a specialized and possibly context-specific role in physiological processes. Further investigation is warranted to uncover the specific cellular contexts and functions in which VEGF145 is actively involved, shedding light on its potential contributions to localized biological activities.

Biological Activity

Immobilized Biotinylated Human VEGF165 at 0.2 μg/mL (100μL/Well) on the plate. Dose response curve for Anti-VEGF165 Antibody hFc with the EC50 of 20.4 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

P15692-4 (A27-R191)

Gene ID
Synonyms
VEGF-AA; VEGF; MVCD1; VAS; VEGFMGC70609; VPF; RP1-261G23.1; MGC70609
AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERR

Molecular Weight

28-32 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78229
Quantity:
MCE Japan Authorized Agent: