1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi)

VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78229
Handling Instructions Technical Support

VEGF165 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is 165 a.a., with molecular weight of 28-32 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

VEGF165 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is 165 a.a., with molecular weight of 28-32 kDa.

Background

VEGF165 is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PGF. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. VEGF-A also binds to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. VEGF165 may be secreted by tumour cells, binds with high affinity to VEGFR-1 and VEGFR-2 receptors[1][2][3][4][5][6][7][8].

Biological Activity

1.Immobilized Biotinylated Human VEGF165 at 0.2 μg/mL (100μL/Well) on the plate. Dose response curve for Anti-VEGF165 Antibody hFc with the EC50 of 20.4 ng/mL determined by ELISA.
2.Immobilized Anti-VEGF165 Antibody at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human VEGF165, His Tag with the EC50 of ≤15 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

P15692-4 (A27-R191)

Gene ID
Molecular Construction
N-term
VEGF165 (A27-R191)
Accession # P15692-4
8*His-Avi
C-term
Protein Length

Partial

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
VEGF-AA; VEGF; MVCD1; VAS; VEGFMGC70609; VPF; RP1-261G23.1; MGC70609
AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERR

Predicted Molecular Mass
22.2 kDa
Molecular Weight

Approximately 28-35 kDa under reduced (R) conditions, 45-60 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

Glycosylation
Yes
Structure/Form
Homodimer
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5-8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78229
Quantity:
MCE Japan Authorized Agent: