Copy Link Print Information

VIPR2 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

VIPR2 protein, serving as a receptor for Vasoactive Intestinal Peptide (VIP) and Pituitary Adenylate Cyclase-Activating Peptide (PACAP-38 and -27), activates adenylyl cyclase and can also couple with phospholipase C. Its versatile signaling pathways emphasize its pivotal role in transducing signals from VIP and PACAP, participating in cellular processes regulated by cyclic AMP and phosphoinositide signaling cascades. VIPR2 Protein, Human (HEK293, Fc) is the recombinant human-derived VIPR2 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • VIPR2 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

VIPR2 protein, serving as a receptor for Vasoactive Intestinal Peptide (VIP) and Pituitary Adenylate Cyclase-Activating Peptide (PACAP-38 and -27), activates adenylyl cyclase and can also couple with phospholipase C. Its versatile signaling pathways emphasize its pivotal role in transducing signals from VIP and PACAP, participating in cellular processes regulated by cyclic AMP and phosphoinositide signaling cascades. VIPR2 Protein, Human (HEK293, Fc) is the recombinant human-derived VIPR2 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

The VIPR2 protein functions as a receptor for Vasoactive Intestinal Peptide (VIP) as well as Pituitary Adenylate Cyclase-Activating Peptide (PACAP-38 and -27). The receptor's activity is mediated by G proteins, leading to the activation of adenylyl cyclase. Additionally, VIPR2 exhibits the capability to couple with phospholipase C, showcasing its versatility in signaling pathways. These interactions highlight the pivotal role of VIPR2 in transducing signals from VIP and PACAP, thereby participating in cellular processes regulated by cyclic AMP and phosphoinositide signaling cascades.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-mFc
  • Accession

    P41587 (E24-V126)

  • Gene ID
    7434  [NCBI]
  • Molecular Construction
    • N-term
    • VIPR2 (E24-V126)
      Accession # P41587
    • mFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    VIPR2; Vasoactive Intestinal Peptide Receptor 2; VPAC2R; Pituitary Adenylate Cyclase-Activating Polypeptide Type III Receptor; Vasoactive Intestinal Polypeptide Receptor 2; VPAC2; Helodermin-Preferring VIP Receptor; VIP And PACAP Receptor 2; PACAP Type II

  • AA Sequence

    ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILV

  • Predicted Molecular Mass

    37.4 kDa

  • Molecular Weight

    Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • VIPR2 Protein, Human (HEK293, Fc) Product Image
    1/16
  • VIPR2 Protein, Human (HEK293, Fc) Product Image