Copy Link Print Information

VNN1/Vanin-1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Vanin-1 (VNN1) is an amide hydrolase that specifically hydrolyzes one carbon amide bond in D-panthionine.The function of this enzyme is essential for recycling pantothenic acid (vitamin B5) and releasing cysteamine.VNN1/Vanin-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VNN1/Vanin-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • VNN1/Vanin-1 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Vanin-1 (VNN1) is an amide hydrolase that specifically hydrolyzes one carbon amide bond in D-panthionine.The function of this enzyme is essential for recycling pantothenic acid (vitamin B5) and releasing cysteamine.VNN1/Vanin-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VNN1/Vanin-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Vanin-1 (VNN1) is an amidohydrolase with the specific function of hydrolyzing one of the carboamide linkages in D-pantetheine. This enzymatic activity plays a crucial role in the recycling of pantothenic acid (vitamin B5), ultimately releasing cysteamine. By facilitating the breakdown of D-pantetheine, VNN1 contributes to the metabolic processes involved in maintaining adequate levels of pantothenic acid, a vital component in various biochemical pathways. This enzymatic action underscores the significance of VNN1 in the regulation of vitamin B5 homeostasis and the release of cysteamine, highlighting its role in cellular metabolism.

Verified Bioactivity

Measured by its ability to 125 μM hydrolyze pantetheine (HY-B1028) to pantothenate and cysteamine that incubated at 37℃ for 30 minutes .The specific activity is >1500 pmol/min/µg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-8*His
  • Accession

    Q9Z0K8 (L24-N488)

  • Gene ID
    22361  [NCBI]
  • Molecular Construction
    • N-term
    • VNN1 (L24-N488)
      Accession # Q9Z0K8
    • 8*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    VNN1; Vanin 1; Pantetheine Hydrolase; Pantetheinase; Vascular Non-Inflammatory Molecule 1; Vannin 1; Vanin-1; Tiff66; HDLCQ8

  • AA Sequence

    LDTFLAAVYEHAVILPKDTLLPVSHSEALALMNQNLDLLEGAIVSAAKQGAHIIVTPEDGIYGVRFTRDTIYPYLEEIPDPQVNWIPCDNPKRFGSTPVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQGKLVARYHKQNIFMGEDQFNVPMEPEFVTFDTPFGKFGVFTCFDILFHDPAVTLVTEFQVDTILFPTAWMDVLPHLAAIEFHSAWAMGMGVNFLAANLHNPSRRMTGSGIYAPDSPRVFHYDRKTQEGKLLFAQLKSHPIHSPVNWTSYASSVESTPTKTQEFQSIVFFDEFTFVELKGIKGNYTVCQNDLCCHLSYQMSEKRADEVYAFGAFDGLHTVEGQYYLQICILLKCKTTNLRTCGSSVDTAFTRFEMFSLSGTFGTRYVFPEVLLSEVKLAPGEFQVSSDGRLVSLKPTSGPVLTIGLFGRLYGKDWASN

  • Predicted Molecular Mass

    53.1 kDa

  • Molecular Weight

    Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • VNN1/Vanin-1 Protein, Mouse (HEK293, His) Product Image
    1/16
  • VNN1/Vanin-1 Protein, Mouse (HEK293, His) Product Image