Vpr Protein, HIV-1 group M subtype G (GST)
Vpr Protein, HIV-1 group M subtype G (GST) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-GST tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Vpr Protein, HIV-1 group M subtype G (GST) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-GST tag.
Background
Vpr is a protein that may deplete host UNG protein and induce G2-M cell cycle arrest during virus replication. It targets specific host proteins for degradation by the 26S proteasome through association with the cellular CUL4A-DDB1 E3 ligase complex by direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting initiation by virion-carried Vpr. Additionally, Vpr induces apoptosis in a cell cycle-dependent manner, indicating mechanistic linkage between these effects. Detected in AIDS patient serum and cerebrospinal fluid, Vpr may also induce bystander cell death.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag N-GST
-
Accession
O89942 (M1-S96)
-
Gene ID/
-
Molecular Construction
-
N-term
-
GST
-
O89942(M1-S96)
Accession # -
C-term
-
-
Protein Length
Full Length
-
Synonyms
vpr; Protein Vpr; R ORF protein; Viral protein R
-
AA Sequence
MEQAPEDQGPQREPYNEWALELLEELKNEAVRHFPRLWLHGLGQHIYNTYGDTWEGVEAIIRILQQLLFIHFRIGCQHSRIGITPRRRVRDGPGRS
-
Predicted Molecular Mass
38.8 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
