Adrenocorticotropic hormone TFA
Based on 1 publication(s) in Google Scholar
Adrenocorticotropic hormone (ACTH; Adrenocorticotrophic hormone) TFA is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone TFA stimulates cortisol secretion from the adrenal cortex via the hypothalamic-pituitary-adrenal (HPA) axis. Adrenocorticotropic hormone TFA regulates cortisol and androgen production. Adrenocorticotropic hormone TFA can promote the development of spermatogenesis. Adrenocorticotropic hormone TFA can relieve acute inflammation in gout models by inhibiting the polarization of macrophages to M1 type, inhibiting ROS and proinflammatory factor production and protecting mitochondrial function. Adrenocorticotropic hormone TFA can be used for the researches of inflammation, endocrinology, metabolic disease, such as gout and nephrotic syndrome.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity: 99.91%
- 화학식: C207H308N56O58S.xC2HF3O2
- 분자량:4541.14 (free base)
-
보관:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) Adrenocorticotropic hormone TFA
More
Biological Activity
|
IL-6 |
IL-1β |
Adrenocorticotropic hormone (100 nM, 5weeks) TFA induces clusters development of spermatogenesis isolated from mouse seminiferous tubules and significantly increases the proportion of pre-meiotic cells (CDH-1, VASA, MC2R-positive) and the expression of PLZF, VASA, MC2R, THY-1 genes[2].
Adrenocorticotropic hormone (100 nM, 5weeks) TFA significantly increases the proportion and gene expression of meiotic marker BOULE-positive cells in cells isolated from mouse seminiferous tubules and has no significant effect on the proportion of meiotic marker CREM-positive cells, increases the proportion of post-meiotic marker ACROSIN-positive cells but decreases its gene expression, and has no effect on the expression of SCP3 and PROTAMINE[2].
Adrenocorticotropic hormone (1.25×10-4-2.5×10-4 U/ml, 48 h) TFA inhibits phagocytic function in MSU-stimulated THP-1-induced macrophages, promotes the polarization of MSU-stimulated macrophages to M2 type, downregulates the secretion of M1-type proinflammatory factors IL-1β, IL-6, and TNF-α, inhibit ROS production and reduces the opening of mitochondrial permeability transition pores (mPTP) to protect mitochondrial function[3].
Adrenocorticotropic hormone (1.25×10-4 U/ml, 48 h) TFA regulates the transcription of inflammation-related genes by upregulating genes such as NR1H2, IL-37, and FccRIIIA, and downregulating genes such as NLRP3, MC2R, and MC3R in THP-1-induced macrophages[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:MSU-induced gout mice models (C57BL/6, 6 weeks)[3]
-
Dosage:0.25 U/mL or 2.5 U/mL
-
Administration:Subcutaneously injection, 30 minutes after MSU intra-articular injection
-
Result:Reduced inflammatory cell infiltration in joint tissues.
Had no significant effect on serum cortisol levels.
Chemical Information
-
Appearance Solid
-
분자량 4541.14 (free base)
-
화학식 C207H308N56O58S.xC2HF3O2
-
Color White to off-white
-
Synonyms
ACTH TFA; Adrenocorticotrophic hormone TFA
-
Sequence
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
-
Sequence Shortening
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cephalalgia
Post-stress modulation of the HPA and melanocortin systems alleviates migraine-like behaviors in mice. [Abstract]2025 Jul;45(7):3331024251352856. PMID: 40632107
용액&용해도
H2O : 50 mg/mL (Need ultrasonic)
순도&문서
-
Data Sheet (273 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Yamamoto R, et al.. Physiology, Adrenocorticotropic Hormone (ACTH). 2025 Dec 1. In: StatPearls [Internet]. Treasure Island (FL): StatPearls Publishing; 2025 Jan–. [Content Brief]
[2]. AbuMadighem A, et al. Adrenocorticotropic hormone and its receptor as a novel testicular system involves in the development of spermatogenesis. Life Sci. 2025 May 1;368:123480. [Content Brief]
[3]. Xu R, et al. Natural Adrenocorticotropic Hormone (ACTH) Relieves Acute Inflammation in Gout Patients by Changing the Function of Macrophages. J Healthc Eng. 2022 Mar 22;2022:9241835. [Content Brief]
[4]. Bomback AS, et al. Treatment of nephrotic syndrome with adrenocorticotropic hormone (ACTH). Discov Med. 2011 Aug;12(63):91-6. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)