UBE2V2 Protein, Human (His)
Based on 1 Customer Validation
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (His) is the recombinant human-derived UBE2V2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (His) is the recombinant human-derived UBE2V2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
The UBE2V2 protein lacks ubiquitin ligase activity when acting alone, but forms a functional heterodimer with UBE2N to catalyze the synthesis of non-canonical poly-ubiquitin chains linked through 'Lys-63'. Notably, this type of poly-ubiquitination does not result in protein degradation by the proteasome. UBE2V2 plays a pivotal role in mediating the transcriptional activation of target genes, exerting influence over cell cycle progression, and contributing to cellular differentiation. Furthermore, it is involved in the error-free DNA repair pathway, enhancing cell survival following DNA damage. UBE2V2 primarily functions as a heterodimer with UBE2N and demonstrates binding affinity for CHFR, suggesting its involvement in various cellular processes and molecular interactions.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q15819 (M1-N145)
-
Molecular Construction
-
N-term
-
6*His
-
UBE2V2 (M1-N145)
Accession # Q15819 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2V2; Ubiquitin Conjugating Enzyme E2 V2; Ubiquitin-Conjugating Enzyme E2 Variant 2; EDPF-1; EDAF-1; MMS2; UEV2; DDVit-1; DDVIT1; UEV-2; EDPF1; Enterocyte Differentiation-Associated Factor 1; Enterocyte Differentiation-Promoting Factor 1; Vitamin D3-Ind
-
AA Sequence
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
-
Predicted Molecular Mass
18.5 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 8% trehalose, 3% Mannitol, 0.03% Tween 80, pH 7.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)