GHRF, bovine
GHRF, bovine (bGRF(1-44)-NH2) is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone (HY-N0583).
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 88894-91-1
- Formel: C220H366N72O66S
- Molecular Weight:5104.72
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
GHRF, bovine (0.001 nM-100 nM; 6 h) increases growth hormone (GH) release from bovine anterior pituitary cells, with maximum release of 262% above control at 100 nM[1].
GHRF, bovine (0.0001 nM-100 nM; 24 h) linearly increases GH secretion and is enhanced by Hydrocortisone (HY-N0583) (Cortisol, 10 ng/mL) in anterior pituitary cells cultured in media containing fetal calf serum (FCS)[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
GHRF, bovine (12 mg/d; i.v.drip; from 118 to 181 d postpartum) also doesn’t alter the mRNA abundance of the erythrocyte-type or the intestinal-type glucose transporter in the kidney of postpartum bovine, but results individual differences in the mRNA abundance of the intestinal-type glucose transporter in liver[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS. Nr. 88894-91-1
-
Molecular Weight 5104.72
-
Formel C220H366N72O66S
-
Synonyms
bGRF(1-44)-NH2
-
Sequence Shortening
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
[1]. Padmanabhan V, et al. Modulation of growth hormone-releasing factor-induced release of growth hormone from bovine pituitary cells. Domest Anim Endocrinol. 1987 Oct;4(4):243-52. [Content Brief]
[2]. Zhao FQ, et al. Regulation of the gene expression of glucose transporter in liver and kidney of lactating cows by bovine growth hormone and bovine growth hormone-releasing factor. J Dairy Sci. 1996 Sep;79(9):1537-42. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)