RANTES/CCL5 Protein, Human (HEK293)

RANTES/CCL5 Protein, Human (HEK293) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human ( HEK293) is a recombinant human RANTES/CCL5(S24-S91) protein expressed by HEK293^[1].

CCL5, also known as RANTES (Regulation of Activation, Expression and Secretion by Normal T Cells), belongs to the CC subfamily of chemokines. The CCL5 gene is located in the q11.2-q12 region of human chromosome 17 and encodes CCL5 a protein with a molecular weight of 8 kDa. CCL5 can be expressed by T cells, monocytes, NK cells, epithelial cells, fibroblasts, and CCL5 can bind to receptors CCR1, CCR3, CCR4 and CCR5, with the highest affinity for CCR5^[1]. CCL5 binding to CCR5 leads to phosphorylation of phosphatidylinositol 3-kinase ( PI3K ), and the phosphorylated PI3K further acidifies protein kinase B on serine 473, and the Akt/PKB complex phosphorylates and inactivates the serine/threonine protein kinase GSK-3. In parallel, CCL5 binding to CCR5 induces Bcl2 protein expression, which promotes cell apoptosis. CCL5 can also act as a potential agonist for the G protein-coupled receptor GPR75, which, together with GPR75, may play a role in neuronal survival by activating downstream signaling pathways involving PI3, Akt, and MAP kinases, and in insulin secretion by pancreatic islet cells by activating GPR75^[2]. In addition to acting as a chemotactic agent, CCL5 is also a major HIV suppressor produced by CD⁸⁺ T cells. It is involved in inflammation maintenance, transplantation, antiviral immunity, tumor development, and many human diseases and disorders such as viral hepatitis or COVID-19^[3].

The ED₅₀ is <0.2 μg/mL as measured by CHO-K1/Gα15/hCCR1 cells (human Gα15 and human CCR1 stably expressed in CHO-K1 cells).

Human

HEK293

Tag Free

P13501 (S24-S91)

6352  [NCBI]

Full Length of Mature Protein

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Approximately 8 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/pbmc-cell.html  [Content Brief]

  [2]. V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22(2):83-7.  [Content Brief]

  [3]. Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9(1):12-27.

  [4]. F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270(5243):1811-5.  [Content Brief]

  [5]. Shih-Wei Wang, et al. CCL5 and CCR5 interaction promotes cell motility in human osteosarcoma. PLoS One. 2012;7(4):e35101.  [Content Brief]