RANTES/CCL5 Protein, Human (HEK293)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

RANTES/CCL5 Protein, Human (HEK293) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human ( HEK293) is a recombinant human RANTES/CCL5(S24-S91) protein expressed by HEK293.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

RANTES/CCL5 Protein, Human (HEK293) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human ( HEK293) is a recombinant human RANTES/CCL5(S24-S91) protein expressed by HEK293[1].

Background

CCL5, also known as RANTES (Regulation of Activation, Expression and Secretion by Normal T Cells), belongs to the CC subfamily of chemokines. The CCL5 gene is located in the q11.2-q12 region of human chromosome 17 and encodes CCL5 a protein with a molecular weight of 8 kDa. CCL5 can be expressed by T cells, monocytes, NK cells, epithelial cells, fibroblasts, and CCL5 can bind to receptors CCR1, CCR3, CCR4 and CCR5, with the highest affinity for CCR5[1]. CCL5 binding to CCR5 leads to phosphorylation of phosphatidylinositol 3-kinase ( PI3K ), and the phosphorylated PI3K further acidifies protein kinase B on serine 473, and the Akt/PKB complex phosphorylates and inactivates the serine/threonine protein kinase GSK-3. In parallel, CCL5 binding to CCR5 induces Bcl2 protein expression, which promotes cell apoptosis. CCL5 can also act as a potential agonist for the G protein-coupled receptor GPR75, which, together with GPR75, may play a role in neuronal survival by activating downstream signaling pathways involving PI3, Akt, and MAP kinases, and in insulin secretion by pancreatic islet cells by activating GPR75[2]. In addition to acting as a chemotactic agent, CCL5 is also a major HIV suppressor produced by CD8+ T cells. It is involved in inflammation maintenance, transplantation, antiviral immunity, tumor development, and many human diseases and disorders such as viral hepatitis or COVID-19[3].

Verified Bioactivity

The ED50 is <0.2 μg/mL as measured by CHO-K1/Gα15/hCCR1 cells (human Gα15 and human CCR1 stably expressed in CHO-K1 cells).

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL5 (S24-S91)
      Accession # P13501
    • C-term
  • Protein Length

    Full Length of C-C motif chemokine 5 Chain

  • Synonyms

    CCL5; T-Cell Specific Protein P288; Prev. D17S136E; C-C Motif Chemokine 5; Prev. SCYA5; MGC17164; TCP228; EoCP; SIS-Delta; Small Inducible Cytokine A5 (RANTES); RANTES; T-Cell Specific RANTES Protein; SISd; T-Cell-Specific Protein RANTES; Regulated Upon A

  • AA Sequence

    SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

  • Molecular Weight

    Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00