RANTES/CCL5 Protein, Human (Biotinylated, His-Avi)

Customer Review

Based on 1 Customer Validation

RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived RANTES/CCL5 protein, expressed by E. coli , with N-Avi, N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived RANTES/CCL5 protein, expressed by E. coli , with N-Avi, N-His labeled tag.

Background

RANTES/CCL5 Protein is a chemoattractant that plays a role in attracting blood monocytes, memory T-helper cells, and eosinophils. It also causes the release of histamine from basophils and activates eosinophils. RANTES can activate several chemokine receptors including CCR1, CCR3, CCR4, and CCR5. It is known to be one of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein has shown to inhibit different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) in a dose-dependent manner. There are different processed forms of RANTES, such as RANTES(3-68), which acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1 infection compared to the other processed forms RANTES(4-68) and RANTES(1-68). RANTES may also act as an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization. It is suggested that RANTES, along with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt, and MAP kinases. Additionally, by activating GPR75, RANTES may also contribute to insulin secretion by islet cells. RANTES can form homo and heterooligomers with other chemokines and has an interaction with the brown dog tick evasin-4.

Verified Bioactivity

1.Immobilized Anti-CCL5 Antibody, hFc Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human CCL5, His Tag with the EC50 of ≤20 ng/mL determined by ELISA.
2.Immobilized Biotinylated Human CCL5, His-Avi Tag at 1 μg/ml (100 μl/Well) on streptavidin (5 μg/ml) precoated plate. Dose response curve for Anti CCL5 Antibody, hFc Tag with the EC50 of 1.0-10.0 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-Avi;N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His-Avi
    • CCL5 (S24-S91)
      Accession # P13501
    • C-term
  • Protein Length

    Full Length of C-C motif chemokine 5 Chain

  • Conjugation

    Biotin

  • Synonyms

    CCL5; T-Cell Specific Protein P288; Prev. D17S136E; C-C Motif Chemokine 5; Prev. SCYA5; MGC17164; TCP228; EoCP; SIS-Delta; Small Inducible Cytokine A5 (RANTES); RANTES; T-Cell Specific RANTES Protein; SISd; T-Cell-Specific Protein RANTES; Regulated Upon A

  • AA Sequence

    SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

  • Predicted Molecular Mass

    10.9 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 0.3%SKL, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00