1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Chemokine & Receptors
  4. CC Chemokines
  5. RANTES/CCL5
  6. RANTES/CCL5 Protein, Human (Biotinylated, His-Avi)

RANTES/CCL5 Protein, Human (Biotinylated, His-Avi)

Cat. No.: HY-P700861
Handling Instructions Technical Support

RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived RANTES/CCL5 protein, expressed by E. coli , with N-Avi, N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived RANTES/CCL5 protein, expressed by E. coli , with N-Avi, N-His labeled tag.

Background

RANTES/CCL5 Protein is a chemoattractant that plays a role in attracting blood monocytes, memory T-helper cells, and eosinophils. It also causes the release of histamine from basophils and activates eosinophils. RANTES can activate several chemokine receptors including CCR1, CCR3, CCR4, and CCR5. It is known to be one of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein has shown to inhibit different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) in a dose-dependent manner. There are different processed forms of RANTES, such as RANTES(3-68), which acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1 infection compared to the other processed forms RANTES(4-68) and RANTES(1-68). RANTES may also act as an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization. It is suggested that RANTES, along with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt, and MAP kinases. Additionally, by activating GPR75, RANTES may also contribute to insulin secretion by islet cells. RANTES can form homo and heterooligomers with other chemokines and has an interaction with the brown dog tick evasin-4.

Biological Activity

1.Immobilized Anti-CCL5 Antibody, hFc Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human CCL5, His Tag with the EC50 of ≤20 ng/mL determined by ELISA.
2.Immobilized Biotinylated Human CCL5, His Tag at 1 μg/ml (100 μl/Well) on streptavidin (5 μg/ml) precoated plate. Dose response curve for Anti CCL5 Antibody, hFc Tag with the EC50 of 5.1-5.6 ng/mL determined by ELISA.

Species

Human

Source

E. coli

Tag

N-Avi;N-8*His

Accession

P13501 (S24-S91)

Gene ID
Molecular Construction
N-term
8*His-Avi
CCL5 (S24-S91)
Accession # P13501
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
MuRantes; SIS-delta; Scya5; Ccl5; D17S136E; eoCP; RANTES; SCYA5; SISd; TCP228; CCL5
AA Sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Molecular Weight

10.89 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 0.3%SKL, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RANTES/CCL5 Protein, Human (Biotinylated, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RANTES/CCL5 Protein, Human (Biotinylated, His-Avi)
Cat. No.:
HY-P700861
Quantity:
MCE Japan Authorized Agent: