RANTES/CCL5 Protein, Human (Biotinylated, His-Avi)
Based on 1 Customer Validation
RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived RANTES/CCL5 protein, expressed by E. coli , with N-Avi, N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived RANTES/CCL5 protein, expressed by E. coli , with N-Avi, N-His labeled tag.
Background
RANTES/CCL5 Protein is a chemoattractant that plays a role in attracting blood monocytes, memory T-helper cells, and eosinophils. It also causes the release of histamine from basophils and activates eosinophils. RANTES can activate several chemokine receptors including CCR1, CCR3, CCR4, and CCR5. It is known to be one of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein has shown to inhibit different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) in a dose-dependent manner. There are different processed forms of RANTES, such as RANTES(3-68), which acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1 infection compared to the other processed forms RANTES(4-68) and RANTES(1-68). RANTES may also act as an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization. It is suggested that RANTES, along with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt, and MAP kinases. Additionally, by activating GPR75, RANTES may also contribute to insulin secretion by islet cells. RANTES can form homo and heterooligomers with other chemokines and has an interaction with the brown dog tick evasin-4.
Verified Bioactivity
1.Immobilized Anti-CCL5 Antibody, hFc Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human CCL5, His Tag with the EC50 of ≤20 ng/mL determined by ELISA.
2.Immobilized Biotinylated Human CCL5, His-Avi Tag at 1 μg/ml (100 μl/Well) on streptavidin (5 μg/ml) precoated plate. Dose response curve for Anti CCL5 Antibody, hFc Tag with the EC50 of 1.0-10.0 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Avi;N-8*His
-
Accession
P13501 (S24-S91)
-
Molecular Construction
-
N-term
-
8*His-Avi
-
CCL5 (S24-S91)
Accession # P13501 -
C-term
-
-
Protein Length
Full Length of C-C motif chemokine 5 Chain
-
Conjugation
Biotin
-
Synonyms
CCL5; T-Cell Specific Protein P288; Prev. D17S136E; C-C Motif Chemokine 5; Prev. SCYA5; MGC17164; TCP228; EoCP; SIS-Delta; Small Inducible Cytokine A5 (RANTES); RANTES; T-Cell Specific RANTES Protein; SISd; T-Cell-Specific Protein RANTES; Regulated Upon A
-
AA Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
-
Predicted Molecular Mass
10.9 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 0.3%SKL, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)