IL-1 beta Protein, Human
Based on 58 publication(s) in Google Scholar
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions. IL-1 beta is produced as inactive pro-IL-1β (encoded by pro-Il-1b) in response to inflammatory stimuli. IL-1 beta Protein, Human consists of 153 amino acids (A117-S269) and is expressed in E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta is produced as inactive pro-IL-1β (encoded by pro-Il-1b) in response to inflammatory stimuli. IL-1 beta Protein, Human consists of 153 amino acids (A117-S269) and is expressed in E. coli.
Background
Interleukin-1β (IL-1β) is one of the pro-inflammatory cytokines and is produced and secreted by a variety of cell types although the vast majority of studies have focussed on its production within cells of the innate immune system, such as monocytes and macrophages[1][2].
IL-1β is produced as inactive pro-IL-1β (encoded by pro-Il-1b) in response to inflammatory stimuli, including both microbial products and endogenous danger-associated molecules. IL-1β gene expression and synthesis of pro-IL-1β occurs after activation of pattern recognition receptors (PRRs). Inflammatory stimuli also drive activation of cytosolic CARD and PYHIN domain-containing PRRs that recruit ASC and caspase-1 (Casp-1) to assemble into the multiprotein complex inflammasome. Pro-Casp-1 (encoded by pro-Casp-1), activated by the inflammasome, cleaves pro-IL-1β into the bioactive IL-1β. IL-1β acts in an autocrine/paracrine manner via the type I IL-1 receptor (IL-1R1)[1][2][3].
IL-1β could regulate the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. IL-1β also plays a significant regulator of reproduction in females[1][2][3].
In Vitro
IL-1β (1-15625 pg/mL; 12 hours) dose-dependently increases production of the NF-κB-dependent inflammatory cytokine TNF-α, and a significant effect of IL-1β is observed at concentrations as low as 5 pg/mL in immortalized murine RAW264.7 macrophages[1].
IL-1β (1, 10 and 100 ng/mL; 24 hours) results in a dose-dependent increase of cell proliferation in pig heart cells. IL-1β increases the gene expression of caspase-3, and increases the enzymatic activities of MMP-2 and MMP-9[2].
In Vivo
IL-1β (8 ng; i.p.; daily; for 3 days) rescues Casp1−/− mice, restores survival and reduces lung bacterial load (i.e. days 0, 1, and 2 post-infection) in Chlamydia pneumoniae infected Casp1−/− mice. Yet, mice treated later (days 2, 3 and 4 post-infection) shows significantly increased bacterial counts relative to early-treated mice[3].
Verified Bioactivity
1.The ED50 is <10 pg/mL as measured by mouse D10S cells, corresponding to a specific activity of 1.0 × 108 IU/mg.
2.Measured by its ability to induce NF-kB signaling in 293-IL1 Res cells. The ED50 for this effect is 20-100 pg/mL.
3. Measured in a proliferation assay using CTLL-2 mouse cells. The ED50 this effect is ≤12.41 pg/mL, corresponding to a specific activity is ≥8.058×107 units/mg.
4.Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is <12 pg/mL, corresponding to a specific activity is >8.333×107 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (58)
-
Journal Impact Factor
-
Most Recent
-
Immunity
Spatiotemporal dynamics of CXCL10 encode contextual immune information revealed by the genetically encoded fluorescent sensor. [Abstract]2025 Sep 9;58(9):2320-2335.e9. PMID: 40818452 -
Adv Mater
A Biologically Lubricating Allicin-Based Nanoplatform for Remodeling the Inflammation-Senescence Axis in the Treatment of Periodontitis. [Abstract]2026 Apr;38(19):e23197. PMID: 41787647 -
Nat Commun
10-hydroxy-2-decenoic acid prevents osteoarthritis by targeting aspartyl β hydroxylase and inhibiting chondrocyte senescence in male mice preclinically. [Abstract]2024 Sep 4;15(1):7712. PMID: 39231947
IL-1 beta Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Sep 4;15(1):7712. [Abstract]
Cell viability of mouse primary chondrocytes treated with 10 ng/ml interleukin-1β (IL1β) in the absence or presence of 0, 2, 5, 10 nM 10-HDA for 48 h.
IL-1 beta Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Sep 4;15(1):7712. [Abstract]
COL2, ACAN, MMP13 protein levels in human cartilage explants treated with 10 ng/ml IL-1β in the absence or presence of 0, 5, 10 nM 10-HDA for 7 d.
IL-1 beta Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Sep 4;15(1):7712. [Abstract]
Cell apoptosis in human C28/I2 chondrocytes treated with 10 ng/mL IL-1β in the absence or presence of 0, 2, 5, 10 nM 10-HDA for 48 h.
-
Adv Sci (Weinh)
CD177 Deficiency Defines a Stable Subtype of Human Neutrophil Granulocytes with Tumor Promoting Activity. [Abstract]2026 Jun 22:e76236. PMID: 42325214 -
Adv Sci (Weinh)
ETV4 Promotes Colorectal Cancer Progression by Reprogramming Asparagine Metabolism to Remodel the Stromal Microenvironment. [Abstract]2026 Mar 20:e16557. PMID: 41861091 -
Sci Adv
Transition of cellular senescence to pyroptosis mediates recurrence of small cell lung cancer after chemotherapy. [Abstract]2025 Jul 11;11(28):eadw1553. PMID: 40644541 -
Research (Wash D C)
Novel lncRNA LncMSTRG.11341.25 Promotes Osteogenic Differentiation of Human Bone Marrow Stem Cells via the miR-939-5p/PAX8 Axis. [Abstract]2025 Feb 6:8:0601. PMID: 39916798 -
J Control Release
An injectable self-lubricating supramolecular polymer hydrogel loaded with platelet lysate to boost osteoarthritis treatment. [Abstract]2024 Dec:376:20-36. PMID: 39362609 -
Cell Commun Signal
IL-1β stimulates ADAMTS9 expression and contributes to preterm prelabor rupture of membranes. [Abstract]2025 Mar 8;23(1):127. PMID: 40057799
IL-1 beta Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Commun Signal. 2025 Mar 8;23(1):127. [Abstract]
IL-1β(10 ng/mL)-induced cytosolic ADAMTS9 and membrane versican protein expression in hAECs were observed.
IL-1 beta Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Commun Signal. 2025 Mar 8;23(1):127. [Abstract]
IL-1β(100 ng/20 μL)-injected mice displayedreduced fetal weights and sizes at birth, which were significantly improved by BAY treatment.
-
Phytomedicine
Wogonin ameliorates osteoarthritis by targeting the STAT3/PIM1 axis to attenuate chondrocyte senescence. [Abstract]2026 Apr:153:157986. PMID: 41722125 -
-
J Transl Med
Resveratrol attenuates inflammation and fibrosis in rheumatoid arthritis-associated interstitial lung disease via the AKT/TMEM175 pathway. [Abstract]2024 May 14;22(1):457. PMID: 38745204 -
Sci China Life Sci
Targeting STING oligomerization with licochalcone D ameliorates STING-driven inflammatory diseases. [Abstract]2024 Dec;67(12):2664-2677. PMID: 39190126 -
Proc Natl Acad Sci U S A
Peptide-based allosteric inhibitor targets TNFR1 conformationally active region and disables receptor-ligand signaling complex. [Abstract]2024 Apr 2;121(14):e2308132121. PMID: 38551841 -
Chin Med J (Engl)
EZH2/miR-142-3p/HMGB1 axis mediates chondrocyte pyroptosis by regulating endoplasmic reticulum stress in knee osteoarthritis. [Abstract]2025 Jan 5;138(1):79-92. PMID: 39704001 -
Int J Biol Macromol
A glycoprotein UGP2A from the medicinal insect Ulomoides dermestoides alleviates deep vein thrombosis via the TLR4/MyD88 signaling pathway. [Abstract]2026 Feb;341(Pt 1):150216. PMID: 41547510 -
Int J Mol Med
Hypercapnia exacerbates the disruption of the blood‑brain barrier by inducing interleukin‑1β overproduction in the blood of hypoxemic adult rats. [Abstract]2020 Aug;46(2):762-772. PMID: 32626911 -
Arch Pharm Res
Cartilage extracellular matrix regeneration with 10-gingerol via KEAP1-NRF2-ARE axis for osteoarthritis therapy. [Abstract]2025 Dec;48(11-12):1460-1481. PMID: 41212495 -
Antioxidants (Basel)
Cooperative Interaction of Hyaluronic Acid with Epigallocatechin-3-O-gallate and Xanthohumol in Targeting the NF-κB Signaling Pathway in a Cellular Model of Rheumatoid Arthritis. [Abstract]2025 Jun 11;14(6):713. PMID: 40563345 -
Free Radic Biol Med
METTL3 deficiency leads to ovarian insufficiency due to IL-1β overexpression in theca cells. [Abstract]2024 May 31:222:72-84. PMID: 38825211 -
Mol Ther Nucleic Acids
miR-140 Attenuates the Progression of Early-Stage Osteoarthritis by Retarding Chondrocyte Senescence. [Abstract]2020 Mar 6:19:15-30. PMID: 31790972 -
Prog Orthod
Inhibition of NCOA4/FTH1-mediated ferritinophagy attenuates ferroptosis in PDLCs and alleviates orthodontically induced inflammatory root resorption. [Abstract]2025 Oct 28;26(1):43. PMID: 41148492 -
-
Inflamm Res
Target Fibroblast-B cell crosstalk via MIF signaling drives pathogenic B cell differentiation and joint damage in knee osteoarthritis. [Abstract]2025 Dec 17;75(1):4. PMID: 41407905 -
Cells
Upregulated Hexokinase-2 in Airway Epithelium Regulates Apoptosis and Drives Inflammation in Asthma via Peptidylprolyl Isomerase F. [Abstract]2025 Jul 1;14(13):1004. PMID: 40643524 -
Commun Biol
KLF9-GRK5-HDAC6 axis aggravates osteoarthritis pathogenesis by promoting chondrocyte extracellular matrix degradation and apoptosis. [Abstract]2025 Jan 8;8(1):23. PMID: 39779910 -
Eur J Pharmacol
Investigating the effects of dendrobine on fibrosis and inflammation in orbital fibroblasts of thyroid-associated ophthalmopathy via network pharmacology, molecular docking, and transcriptomics. [Abstract]2025 Sep 5:1002:177871. PMID: 40544935 -
Int Immunopharmacol
Perillaldehyde protect chondrocytes from mitophagy-associated apoptosis and NLRP3-mediated inflammation by regulating ALOX5/NF-kB signaling in osteoarthritis. [Abstract]2025 Jun 17:158:114820. PMID: 40378435 -
Int Immunopharmacol
Long non-coding RNA NRIR inhibits osteogenesis in peri-implantitis by promoting NLRP3 inflammasome-mediated macrophage pyroptosis. [Abstract]2025 Feb 20:148:114180. PMID: 39874847 -
Int Immunopharmacol
YY1/miR-140-5p/Jagged1/Notch axis mediates cartilage progenitor/stem cells fate reprogramming in knee osteoarthritis. [Abstract]2023 Aug:121:110438. PMID: 37295026 -
Int Immunopharmacol
Senescence-responsive miR-33-5p promotes chondrocyte senescence and osteoarthritis progression by targeting SIRT6. [Abstract]2023 Aug:121:110506. PMID: 37343371 -
Int Immunopharmacol
miR-140-5p protects cartilage progenitor/stem cells from fate changes in knee osteoarthritis. [Abstract]2023 Jan:114:109576. PMID: 36527878 -
Arthritis Res Ther
Pulsed electromagnetic field ameliorates the progression of osteoarthritis via the Sirt1/NF-κB pathway. [Abstract]2025 Feb 14;27(1):33. PMID: 39953605 -
Inflammation
miR-496/MMP10 Is Involved in the Proliferation of IL-1β-Induced Fibroblast-Like Synoviocytes Via Mediating the NF-κB Signaling Pathway. [Abstract]2021 Aug;44(4):1359-1369. PMID: 33548006 -
Molecules
Resveratrol Ameliorates Fibrosis in Rheumatoid Arthritis-Associated Interstitial Lung Disease via the Autophagy-Lysosome Pathway. [Abstract]2022 Dec 2;27(23):8475. PMID: 36500562 -
Sci Rep
IL-1β alleviates suppressive potential of bone marrow mesenchymal stem cells in macrophage M1 polarization via autophagy mediated degradation of SPP1. [Abstract]2026 May 20. PMID: 42156848 -
Sci Rep
Analysis of vaginal flora diversity and study on the role of Porphyromonas asaccharolytica in promoting IL-1β in regulating cervical cancer. [Abstract]2024 Sep 17;14(1):21731. PMID: 39289490 -
Am J Pathol
Apoptosis Signal-Regulated Kinase-1 Promotes Nucleus Pulposus Cell Senescence and Apoptosis to Regulate Intervertebral Disc Degeneration. [Abstract]2024 Sep;194(9):1737-1751. PMID: 38879082 -
Mediators Inflamm
2021 Jan 6:2021:5318369. PMID: 33505213 -
Mol Cell Biochem
Nitric oxide induces apoptosis of human primary melanocytes by regulating calcium homeostasis via VDAC1. [Abstract]2025 Aug 3. PMID: 40753527 -
J Inflamm Res
Unveiling the Therapeutic Potential of Baicalin in Intervertebral Disc Degeneration: Integrative Bulk and Single-Cell Transcriptome Analysis with Experimental Validation of PANoptosis Inhibition. [Abstract]2025 May 30:18:6963-6981. PMID: 40463856 -
FASEB J
MiR•101 and miR•122 Targeting δ-Catenin to Regulate Keratinocyte Responsiveness to IL-17A in Psoriasis. [Abstract]2025 Apr 15;39(7):e70539. PMID: 40202916 -
-
J Orthop Surg Res
2025 Dec 29;20(1):1092. PMID: 41466292 -
Immun Inflamm Dis
PCSK9 promotes T helper 1 and T helper 17 cell differentiation by activating the nuclear factor-κB pathway in ankylosing spondylitis. [Abstract]2023 May;11(5):e870. PMID: 37249282 -
-
Vet Microbiol
The critical role of NLRP3 inflammasome activation in Streptococcus suis-induced blood-brain barrier disruption. [Abstract]2024 Aug:295:110161. PMID: 38945021 -
PLoS One
Overexpression of RAD54L attenuates osteoarthritis by suppressing the HIF-1α/VEGF signaling pathway: Bioinformatics analysis and experimental validation. [Abstract]2024 Apr 9;19(4):e0298575. PMID: 38593124 -
Orthod Craniofac Res
Compressive Stress and Inflammation Induce Ferroptosis in Periodontal Ligament Cells Through ACSL4 Activation in Orthodontically Induced Inflammatory Root Resorption. [Abstract]2025 Jun 28. PMID: 40579979 -
Am J Reprod Immunol
Lipoxin A4 depresses inflammation and promotes autophagy via AhR/mTOR/AKT pathway to suppress endometriosis. [Abstract]2023 Mar;89(3):e13659. PMID: 36412044 -
J Physiol Pharmacol
The effect of microRNA-663b in the inhibition of interleukin-1-induced nucleus pulposus cell apoptosis and inflammatory response. [Abstract]2023 Feb;74(1). PMID: 37245236 -
bioRxiv
Epigenetic de-repression of basal cell metaplasia in aging AT2 cells is a risk factor for idiopathic pulmonary fibrosis (IPF). [Abstract]2026 Jun 10:2026.06.09.731212. PMID: 42327275 -
-
-
-
Heliyon
Leptin protects chondrocytes by inhibiting autophagy via phosphoinositide 3 kinase/protein kinase B/mammalian target of rapamycin signaling pathway. [Abstract]2024 Aug 6;10(15):e35665. PMID: 39170379 -
-
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P01584 (A117-S269)
-
Molecular Construction
-
N-term
-
IL-1β (A117-S269)
Accession # P01584 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL1B; IL-1B; Interleukin 1 Beta; Multifunctional Fusion Protein; IL1F2; Pro-Interleukin-1-Beta; Interleukin-1 Beta; Preinterleukin 1 Beta; IL1-BETA; Interleukin 1beta; IL-1 Beta; IL1beta; Catabolin; IL-1
-
AA Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 15-21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122(10):3476-89. [Content Brief]
[2]. Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399(4):542-7. [Content Brief]
[3]. Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6(6):e21477. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)