IL-22 Protein, Mouse
Based on 1 publication(s) in Google Scholar
IL-22 Protein, Mouse plays a prominent role in epithelial regeneration and dampening of chronic inflammatory responses by protecting intestinal stem cells from immune-mediated tissue damage.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
IL-22 Protein, Mouse plays a prominent role in epithelial regeneration and dampening of chronic inflammatory responses by protecting intestinal stem cells from immune-mediated tissue damage.
Interleukin-22 (IL-22) is a member of the IL-10 family of cytokines, expressed predominantly by subsets of innate lymphoid cells (ILCs) and activated T cells, including T helper 1 (TH1) cells, TH17 cells and TH22 cells. IL-22 can be recognized by a heterodimeric receptor complex that consists of two transmembrane subunits: IL-22R1 and IL-10R2. The binding of IL-22 to its receptor activates the JAK/STAT and MAPK signaling pathway, resulting in gene expression or repression. Since the IL-10R2 is shared by five cytokines (IL-10, IL-22, IL-26, IL-28, and IL-29) and is widely expressed in most cells, the expression of the IL-22R1 determines whether a cell is the target of IL-22. IL-22 has a considerable therapeutic potential in graft-versus-host disease (GVHD), which is a frequent and challenging complication following allogeneic stem cell transplantation[1].
1.The ED50 is <0.5 ng/mL as measured by COLO 205 cells.
2.Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is ≤292.3 pg/mL, corresponding to a specific activity is ≥3.42×106 U/mg.
-
Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 292.3 pg/mL, corresponding to a specific activity is 3.42×106 U/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Rep
4-octyl itaconate inhibits cytokine-mediated inflammation via alkylation of TYK2 and JAK1. [Abstract]2026 Mar 30;45(4):117179. PMID: 41915469
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9JJY9 (L34-V179)
-
Molecular Construction
-
N-term
-
IL-22 (L34-V179)
Accession # Q9JJY9 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
rMuIL-22; Cytokine Zcyto 18; IL-TIF
-
AA Sequence
LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
-
Predicted Molecular Mass
16.7 kDa
-
Molecular Weight
Approximately 15-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, pH 6.5, 300 mM NaCl.
3.Lyophilized from a 0.22 μm filtered solution of PBS.
4.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 10 mM imidazole, pH 8.0.
5.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
