IL-18 Protein, Rat

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN)-γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN)-γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.

Background

Interleukin (IL)-18 is a potent stimulator of immunity and augments the severity of type II collagen-induced arthritis (CIA) in rats and mice by enhancing T helper 1 (Th1) cell activation, which increases the production of proinflammatory cytokines and arthritogenic antibodies. IL-18 possesses immunoregulatory activities, including the stimulation of interferon (IFN)-g production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation[1].

Verified Bioactivity

1.The ED50 is <2 μg/mL resulted in the secretion of 0.15 ng/mL hIFN-gamma as measured by KG-1 cells, corresponding to a specific activity of >500 units/mg.
2.Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells. The ED50 for this effect is 0.055 μg/mL, corresponding to a specific activity is 1.818×10^4 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells. The ED50 for this effect is 0.055 μg/mL, corresponding to a specific activity is 1.818×104 U/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-18 (H37-S194)
      Accession # P97636-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IL18; Interleukin 18 (Interferon-Gamma-Inducing Factor); Interleukin 18; IFN-Gamma-Inducing Factor; IL-18; Interleukin-1 Gamma; IL1F4; Iboctadekin; IGIF; IL-1 Gamma; Interleukin-18; Interferon-Gamma-Inducing Factor; IL-1g; Interferon Gamma-Inducing Factor

  • AA Sequence

    HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 50 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00