Copy Link Print Information

GM-CSF Protein, Rhesus macaque

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

GM-CSF Protein, Rhesus macaque functions as a cytokine and affects many cell types, especially macrophages and eosinophils.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for GM-CSF Protein, Rhesus macaque
  • Experimental Validation Results for GM-CSF Protein, Rhesus macaque
  • GM-CSF Protein, Rhesus macaque Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GM-CSF Protein, Rhesus macaque functions as a cytokine and affects many cell types, especially macrophages and eosinophils.

Background

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) is a monomeric glycoprotein that functions as a cytokine —it is a white blood cell growth factor[1]. GM-CSF stimulates stem cells to produce granulocytes (neutrophils, eosinophils, and basophils) and monocytes. Monocytes exit the circulation and migrate into tissue, whereupon they mature into macrophages and dendritic cells. GM-CSF also has some effects on mature cells of the immune system. These include, for example, inhibiting neutrophil migration and causing an alteration of the receptors expressed on the cells surface[2]. GM-CSF also plays a role in embryonic development by functioning as an embryokine produced by reproductive tract[3].

Verified Bioactivity

The ED50 is <0.1 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >1.0 × 107 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells.. The ED50 for this effect is 23.60 pg/mL, corresponding to a specific activity is 4.24×107 units/mg.

Technical Parameters

  • Species Rhesus Macaque
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q9GL44 (A18-E144)

  • Gene ID
    574371  [NCBI]
  • Molecular Construction
    • N-term
    • GM-CSF (A18-E144)
      Accession # Q9GL44
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CSF2; Molgramostim; Colony Stimulating Factor 2; Molgramostin; GMCSF; CSF; Sargramostim; Granulocyte-Macrophage Colony Stimulating Factor; GM-CSF; Granulocyte Macrophage-Colony Stimulating Factor; Colony Stimulating Factor 2 (Granulocyte-Macrophage); Colo

  • AA Sequence

    APARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVVSEMFDLQEPSCLQTRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFQSFKENLKDFLLVIPFDCWEPVQE

  • Predicted Molecular Mass

    14.4 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Francisco-Cruz A, et al. Granulocyte-macrophage colony-stimulating factor: not just another haematopoietic growth factor. Med Oncol. 2014 Jan;31(1):774. [Content Brief]

[2]. Gasson JC, et al. Molecular physiology of granulocyte-macrophage colony-stimulating factor. Blood. 1991 Mar 15;77(6):1131-45. [Content Brief]

[3]. Hansen PJ, et al. Programming of the preimplantation embryo by the embryokine colony stimulating factor 2. Anim Reprod Sci. 2014 Sep;149(1-2):59-66. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 human erythroleukemic cells.. The ED50 for this effect is 23.60 pg/mL, corresponding to a specific activity is 4.24×107 units/mg.

  • GM-CSF Protein, Rhesus macaque Product Image
    1/16
  • Experimental Validation Results for GM-CSF Protein, Rhesus macaque
  • Experimental Validation Results for GM-CSF Protein, Rhesus macaque
  • GM-CSF Protein, Rhesus macaque Product Image