P9R
P9R is an antiviral peptide. P9R has broad-spectrum antiviral activities against the coronaviruses (SARS-CoV-2, MERS-CoV and SARS-CoV), A(H1N1)pdm09, A(H7N9) virus, and rhinovirus. P9R directly binds to viruses and inhibits virus-host endosomal acidification. P9R significantly protects mice from A(H1N1)pdm09 infection without generating drug-resistant virus. P9R can be used for pH-dependent respiratory viruses research.
For research use only. We do not sell to patients.
- CAS No.: 2484874-12-4
- Formula: C144H232N52O35S5
- Molecular Weight:3412.04
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
Chemical Information
-
CAS No. 2484874-12-4
-
Molecular Weight 3412.04
-
Formula C144H232N52O35S5
-
Sequence
Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg
-
Sequence Shortening
NGAICWGPCPTAFRQIGNCGRFRVRCCRIR
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)