Exendin-4 (3-39)
Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis.
For research use only. We do not sell to patients.
- CAS No.: 196109-31-6
- Formula: C176H272N46O58S
- Molecular Weight:3992.44
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Rats[2]
-
Dosage:5 μg/kg
-
Administration:Intraperitoneal injections
-
Result:Increased circulating corticosterone levels in a time-dependent manner both in conscious and anaesthetized rats and also increased aldosterone levels.
Chemical Information
-
CAS No. 196109-31-6
-
Molecular Weight 3992.44
-
Formula C176H272N46O58S
-
Sequence Shortening
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)