ACER2 - alkaline ceramidase 2 Gene

Also Known as ASAH3L; ALKCDase2

Species: Homo sapiens

Gene Type: protein coding
Gene ID: 340485

About ACER2

Cytogenetic location: 9p22.1 Genomic coordinates (GRCh38): 9:19,409,009-19,452,505 (from NCBI)

This gene has 1 transcript (splice variant), 212 orthologues and 2 paralogues. Biased expression in stomach (RPKM 29.1), urinary bladder (RPKM 17.8) and 8 other tissues.

Summary

The sphingolipid metabolite sphingosine-1-phosphate promotes cell proliferation and survival, whereas its precursor, sphingosine, has the opposite effect. The Ceramidase ACER2 hydrolyzes very long chain ceramides to generate sphingosine (Xu et al., 2006 [PubMed 16940153]).[supplied by OMIM, Jul 2010]

ACER2 Products (1)

mRNA Protein Name
NM_001010887.3 NP_001010887.2 alkaline ceramidase 2

Gene Ontology

  • Molecular Function
  • Biological Process
  • Cellular Component
Molecular Function GO Annotation Evidence References Source
enables N-acylsphingosine amidohydrolase activity IDA
IDA: Inferred from direct assay
16940153 GOA
enables N-acylsphingosine amidohydrolase activity IMP
IMP: Inferred from mutant phenotype
20207939 GOA
enables protein binding IPI
IPI: Inferred from physical interaction
32296183 GOA
Biological Process GO Annotation Evidence References Source
involved in DNA damage response IDA
IDA: Inferred from direct assay
26943039 GOA
involved in DNA damage response, signal transduction by p53 class mediator IMP
IMP: Inferred from mutant phenotype
28294157 GOA
involved in activation of cysteine-type endopeptidase activity involved in apoptotic process IMP
IMP: Inferred from mutant phenotype
20628055 GOA
involved in cellular response to xenobiotic stimulus IEP
IEP: Inferred from expression pattern
20628055 GOA
involved in ceramide catabolic process IMP
IMP: Inferred from mutant phenotype
16940153 GOA
involved in negative regulation of cell adhesion mediated by integrin IDA
IDA: Inferred from direct assay
18945876 GOA
involved in negative regulation of cell-matrix adhesion IDA
IDA: Inferred from direct assay
18945876 GOA
involved in positive regulation of cell population proliferation IDA
IDA: Inferred from direct assay
16940153 GOA
involved in regulation of apoptotic process IMP
IMP: Inferred from mutant phenotype
26943039 GOA
involved in regulation of autophagy IMP
IMP: Inferred from mutant phenotype
28294157 GOA
involved in regulation of protein glycosylation IMP
IMP: Inferred from mutant phenotype
20089856 GOA
involved in response to retinoic acid IDA
IDA: Inferred from direct assay
18945876 GOA
involved in sphingosine biosynthetic process IDA
IDA: Inferred from direct assay
16940153 GOA
involved in sphingosine biosynthetic process IMP
IMP: Inferred from mutant phenotype
20207939 GOA
Cellular Component GO Annotation Evidence References Source
located in Golgi apparatus IDA
IDA: Inferred from direct assay
16940153 GOA
located in Golgi membrane IDA
IDA: Inferred from direct assay
20089856 GOA
EXP: Inferred from Experiment IDA: Inferred from direct assay IPI: Inferred from physical interaction IMP: Inferred from mutant phenotype IGI: Inferred from genetic interaction IEP: Inferred from expression pattern

ACER2 Protein Structure

Ceramidase

Ceramidase: Ceramidase (10 - 261)

  • 0
  • 100
  • 200
  • 275 a.a.
Protein Preferred Names Protein Names

alkaline ceramidase 2

  • alkCDase 2

Related Diseases

Diseases Alias
Farber Lipogranulomatosis

  • Farber Disease

  • Acid Ceramidase Deficiency

  • Ceramidase Deficiency

  • Ac Deficiency

  • N-Laurylsphingosine Deacylase Deficiency

  • Farber'S Disease

  • FRBRL

  • Farber'S Lipogranulomatosis

  • Acylsphingosine Deacylase Deficiency

  • Farber-Uzman Syndrome

  • Acy
Spinal Muscular Atrophy With Progressive Myoclonic Epilepsy

  • Jankovic-Rivera Syndrome

  • SMAPME

  • Sma-Pme

  • Spinal Muscular Atrophy-Progressive Myoclonic Epilepsy Syndrome

  • Hereditary Myoclonus-Progressive Distal Muscular Atrophy Syndrome

  • Hereditary Myoclonus With Progressive Distal Muscular Atrophy

  • Jankovic Rivera Syndrome

  • Myoclonus, Hereditary, With Progressive Distal Muscular Atrophy

  • Myoclonus Hereditary Progressive Distal Muscular Atrophy

  • Atrophy, Muscular, Spinal, With Progressive Myoclonic Epilepsy
Hereditary Sensory And Autonomic Neuropathy Type 1

  • Hereditary Sensory And Autonomic Neuropathy Type I

  • Hereditary Sensory Neuropathy-Deafness-Dementia Syndrome

  • Hsan1e

  • Hsan1

  • Dnmt1-Related Dementia, Deafness, And Sensory Neuropathy

  • Hsn1e

  • Hsnie

  • Hereditary Sensory Neuropathy Type Ie

  • Hereditary Sensory Neuropathy-Sensorineural Hearing Loss-Dementia Syndrome

  • Hereditary Sensory And Autonomic Neuropathy Type Ie

  • Hereditary Sensory And Autonomic Neuropathy Type 1e

  • Hereditary Sensory Neuropathy With Hearing Loss And Dementia

  • Dnmt1-Complex Disorder

  • Hereditary Sensory And Autonomic Neuropathy Type 1 With Dementia And Hearing Loss

  • Hsn Ie

  • Hereditary Sensory Autonomic Neuropathy, Type 1

  • Hsan1- [Hereditary Sensory And Autonomic Neuropathy Type I]
Diseases Alias
Waldenstroem'S Macroglobulinemia

Waldenstroem'S Macroglobulinemia

Waldenstroem'S Macroglobulinemia

Macroglobulinemia Of Waldenstrom

Lymphoplasmacytic Lymphoma With Igm Gammopathy

Lymphoplasmacytic Lymphoma

Waldenstroem'S Macroglobulinemia

Waldenstroem'S Macroglobulinemia

Macroglobulinemia Of Waldenstrom

Lymphoplasmacytic Lymphoma With Igm Gammopathy

Lymphoplasmacytic Lymphoma

Related Agents

  • Approval
  • Clinical Phase
  • Pre-clinical Phase

Approval

Bioactive Molecules (3)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-13771 Ursodeoxycholic acid 99.94% Unkown
HY-B0260 Methylprednisolone 99.78% Yes
HY-12404 Diminazene aceturate 99.39% Unkown
Bioactive MoleculesInhibitory Antibodies (2)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-P99346 Regdanvimab Inhibitor 95.00% Unkown
HY-P9801 Anti-Spike-RBD mAb / Unkown

Clinical Phase

Bioactive Molecules (2)
Cat. No. Product Name Effect
Purity Phase
HY-19414 MLN-4760 Inhibitor 99.93% Phase 2
HY-19088 Oberadilol Ligand / Phase 2

Pre-clinical Phase

Bioactive Molecules (69)
Cat. No. Product Name
Effect
Purity
Rare Diseases
HY-14393 Emodin Inhibitor 99.25% Yes
HY-110066 (Z)-Guggulsterone 99.41% Unkown
HY-138113 Pyrrothiogatain Inhibitor 98.61% Unkown
HY-N0217 Benzoylaconine 99.92% Unkown
HY-N0639 Punicalin 99.88% Unkown
HY-15275 BMS-265246 Inhibitor 99.59% Unkown
HY-120852 JG26 98.14% Unkown
HY-N2116 Ginkgolic acid C17:1 99.80% Unkown
HY-113478S Ursodeoxycholic acid-d4 99.52% Unkown
HY-B0260R Methylprednisolone (Standard) 98.90% Unkown
HY-P2536 Mca-Ala-Pro-Lys(Dnp)-OH 99.95% Unkown
HY-100450 BML-111 Inhibitor 98.87% Unkown
HY-P2222 DX600 Inhibitor 99.71% Unkown
HY-14393R Emodin (Standard) Inhibitor 98.84% Unkown
HY-163943 UNI418 Inhibitor 99.61% Unkown
HY-138067 SSAA09E2 Inhibitor 98.37% Unkown
HY-P2616A Mca-YVADAP-Lys(Dnp)-OH TFA Chemical 98.29% Unkown
HY-19414A (R)-MLN-4760 Inhibitor 99.51% Unkown
HY-126419 Kobophenol A Inhibitor 99.90% Unkown
HY-B0260S4 Methylprednisolone-d2 99.11% Unkown
HY-D1270 Direct Violet 1 Inhibitor / Unkown
HY-P2222A DX600 TFA Inhibitor 99.20% Unkown
HY-157154 MAT-POS-e194df51-1 Inhibitor 98.45% Unkown
HY-122445 Resorcinolnaphthalein Activator 99.87% Unkown
HY-179630 MS102 Inhibitor / Unkown
HY-B0260S Methylprednisolone-d3 / Unkown
HY-B0260S3 Methylprednisolone-d7 99.73% Unkown
HY-P3141 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN 95.28% Unkown
HY-P3142 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ 96.51% Unkown
HY-P5407A HD5 TFA Inhibitor 95.30% Unkown
HY-RS00152 ACE2 Human Pre-designed siRNA Set A / Unkown
HY-W342283 Diminazene / Unkown
HY-B0260S6 Methylprednisolone-d3-1 / Unkown
HY-RS00001 ACE2 Rat Pre-designed siRNA Set A Pre-designed Set / Unkown
HY-14393S Emodin-d4 Inhibitor / Unkown
HY-121068 Bisoxatin Inhibitor / Unkown
HY-121421 Diniprofylline Inhibitor / Unkown
HY-149373 Garcinone B Inhibitor / Unkown
HY-149767 CMX990 Inhibitor 96.63% Unkown
HY-156441 SARS-CoV-2-IN-65 Inhibitor / Unkown
HY-156862 (+)-Chloroquine Activator / Unkown
HY-157966 SARS-CoV-2 3CLpro-IN-23 Inhibitor / Unkown
HY-158073 ML2006a4 Inhibitor / Unkown
HY-161261 SARS-CoV-2-IN-81 Inhibitor / Unkown
HY-168267 XH161-180 Inhibitor / Unkown
HY-169405 AAK1/HDACs-IN-1 Inhibitor / Unkown
HY-169977 CKP-25 Inhibitor / Unkown
HY-170767 SARS-CoV-2-IN-109 Inhibitor / Unkown
HY-174350 CK2-IN-15 Inhibitor / Unkown
HY-174373 SARS-CoV-2-IN-113 Inhibitor / Unkown
HY-178160 SARS-CoV-2 PLpro-IN-2 Inhibitor / Unkown
HY-179634 ASF-006 sodium Inhibitor / Unkown
HY-181066 ACE2-SP PPI-IN-1 Inhibitor / Unkown
HY-B0260S2 Methylprednisolone-d4 / Unkown
HY-P11464 SARS-CoV-2 Spike receptor binding domain, RBD (371-394) / Unkown
HY-P2616 Mca-YVADAP-Lys(Dnp)-OH Chemical / Unkown
HY-P3258 SP-10 / Unkown
HY-P4546 Abz-Ser-Pro-3-nitro-Tyr / Unkown
HY-P5827 SBP1 peptide / Unkown
HY-RS00154 ACER2 Human Pre-designed siRNA Set A Pre-designed Set / Unkown
HY-161070 Antiviral agent 46 Inhibitor / Unkown
HY-162550 Jobosic acid Inhibitor / Unkown
HY-162598 CET-1 Inhibitor / Unkown
HY-175325 SARS-CoV-2-IN-116 Inhibitor / Unkown
HY-175475 MolPort-010-778-422 Inhibitor / Unkown
HY-175697 Glycosyltransferase-IN-2 Inhibitor / Unkown
HY-180129 SARS-CoV-2-IN-120 Inhibitor / Unkown
HY-P5407 HD5 Inhibitor / Unkown
HY-RS16513 Ace2 Mouse Pre-designed siRNA Set A Pre-designed Set / Unkown
Bioactive MoleculesInhibitory Antibodies (5)
Cat. No. Product Name
Effect
Purity
Rare Diseases
HY-P990180 Anti-Mouse NKG2A/C/E Antibody (20D5) Inhibitor 95.00% Unkown
HY-P990731 Canvircept / Unkown
HY-P990814 Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34) Inhibitor / Unkown
HY-P990815 Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01) Inhibitor / Unkown
HY-P991491 VIR-7229 Inhibitor / Unkown

Orthologs Information

Species Symbol Source ID
Felis catus ACER2 VGNC VGNC:59507
Rattus norvegicus ACER2 RGD RGD:1304629
Canis familiaris ACER2 VGNC VGNC:37505
Bos taurus ACER2 VGNC VGNC:25537
Mus musculus ACER2 MGD MGI:1920932
Macaca mulatta ACER2 VGNC VGNC:103235
Others ACER2 NCBI