GHRF, bovine
GHRF, bovine (bGRF(1-44)-NH2) is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone (HY-N0583).
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- CAS No.: 88894-91-1
- 화학식: C220H366N72O66S
- 분자량:5104.72
-
보관:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocol
- 순도&문서
- References
-
Help & FAQs
Biological Activity
제품 설명
In Vitro
GHRF, bovine (0.001 nM-100 nM; 6 h) increases growth hormone (GH) release from bovine anterior pituitary cells, with maximum release of 262% above control at 100 nM[1].
GHRF, bovine (0.0001 nM-100 nM; 24 h) linearly increases GH secretion and is enhanced by Hydrocortisone (HY-N0583) (Cortisol, 10 ng/mL) in anterior pituitary cells cultured in media containing fetal calf serum (FCS)[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
In Vivo
GHRF, bovine (12 mg/d; i.v.drip; from 118 to 181 d postpartum) also doesn’t alter the mRNA abundance of the erythrocyte-type or the intestinal-type glucose transporter in the kidney of postpartum bovine, but results individual differences in the mRNA abundance of the intestinal-type glucose transporter in liver[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 88894-91-1
-
분자량 5104.72
-
화학식 C220H366N72O66S
-
Synonyms
bGRF(1-44)-NH2
-
Sequence Shortening
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocol
-
Research Protocol for Endocrine Diseases
Endocrine diseases often arise from disrupted hormone production, hormone signaling, or target-tissue responsiveness; for diabetes-focused endocrine disease models, insulin signaling regulates glucose uptake, hepatic glucose output, lipid metabolism, and β-cell compensation. Type 2 diabetes develops through interacting defects in insulin resistance, β-cell dysfunction, adipose inflammation, hepatic glucose overproduction, altered incretin signaling, and ectopic lipid metabolism. A major unresolved question is whether endocrine dysfunction is driven primarily by target-tissue insulin resistance, intrinsic β-cell failure, immune/inflammatory stress, or combined multi-organ failure that differs by disease stage.
순도&문서
References
[1]. Padmanabhan V, et al. Modulation of growth hormone-releasing factor-induced release of growth hormone from bovine pituitary cells. Domest Anim Endocrinol. 1987 Oct;4(4):243-52. [Content Brief]
[2]. Zhao FQ, et al. Regulation of the gene expression of glucose transporter in liver and kidney of lactating cows by bovine growth hormone and bovine growth hormone-releasing factor. J Dairy Sci. 1996 Sep;79(9):1537-42. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
GHRF, bovine Related Classifications
HY-P3607 Related Classifications
Powered by Bioz