Peptide YY (pig)
Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- CAS No.: 81858-94-8
- 화학식: C190H288N54O57
- 분자량:4240.72
-
보관:
Please store the product under the recommended conditions in the Certificate of Analysis.
All Neuropeptide Y Receptor Isoforms
More
Biological Activity
제품 설명
IC50 & Target
[3]|
NPY Y2 receptor |
In Vitro
Peptide YY (pig) (10 μg/mL) has antibody specificity (for PYY antiserum), as well as human pancreatic polypeptide (PP). Both of them may play endocrine or paracrine roles in the regulation of islet hormone secretion in various vertebrate species[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
Peptide YY1-36 (pig) shows other physiological effects including slowing of intestinal transit, inhibition of gastrointestinal anion and electrolyte secretion and lowering of blood glucose[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 81858-94-8
-
분자량 4240.72
-
화학식 C190H288N54O57
-
Sequence Shortening
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Please store the product under the recommended conditions in the Certificate of Analysis.
순도&문서
References
[1]. Lundberg JM, et al. Localization of peptide YY (PYY) in gastrointestinal endocrine cells and effects on intestinal blood flow and motility. Proc Natl Acad Sci U S A. 1982 Jul;79(14):4471-5. [Content Brief]
[2]. Ding WG, et al. Neuropeptide Y and peptide YY immunoreactivities in the pancreas of various vertebrates. Peptides. 1997;18(10):1523-9. [Content Brief]
[3]. Olsen J, et al. Metabolism of peptide YY 3-36 in Göttingen mini-pig and rhesus monkey. Peptides. 2016 Apr;78:59-67. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)