Chlorotoxin TFA
Based on 2 publication(s) in Google Scholar
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker. Anti-cancer activity.
For research use only. We do not sell to patients.
- Purity : 97.04%
- Formula: C158H249N53O47S11.xC2HF3O2
- Molecular Weight:3995.71 (free base)
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) Chlorotoxin TFA
More
Biological Activity
Description
Chemical Information
-
Appearance Solid
-
Molecular Weight 3995.71 (free base)
-
Formula C158H249N53O47S11.xC2HF3O2
-
Color White to off-white
-
Sequence
Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 (Disulfide bridge: Cys2-Cys19,Cys5-Cys28,Cys16-Cys33,Cys20-Cys35)
-
Sequence Shortening
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: Cys2-Cys19,Cys5-Cys28,Cys16-Cys33,Cys20-Cys35)
-
Structure Classification
-
Initial Source
the venom of the scorpion Leiurus quinquestriatus
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Pain
Difference of pain vulnerability in adult and juvenile rodents: the role of SIRT1-mediated ClC-3 trafficking in sensory neurons. [Abstract]2021 Jun 1;162(6):1882-1896. PMID: 33433144 -
Biochim Biophys Acta Mol Basis Dis
ClC-3 inhibition induces autophagy to reverse cisplatin resistance in cervical cancer via the Akt/mTOR pathway. [Abstract]2025 Sep 2;1872(1):168030. PMID: 40907802
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 33.33 mg/mL (Need ultrasonic)
Purity & Documentation
-
Data Sheet (285 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. DeBin JA, et al. Purification and characterization of chlorotoxin, a chloride channel ligand from the venom of the scorpion. Am J Physiol. 1993 Feb;264(2 Pt 1):C361-9. [Content Brief]
[2]. Ojeda PG, et al. Chlorotoxin: Structure, activity, and potential uses in cancer therapy. Biopolymers. 2016 Jan;106(1):25-36. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)