Peptide YY (PYY) (3-36), porcine TFA
Based on 3 publication(s) in Google Scholar
Peptide YY (PYY) (3-36), porcine TFA is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.
For research use only. We do not sell to patients.
- Purity : 99.97%
- Formula: C176H272N52O54.C2HF3O2
- Molecular Weight:4094.44
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) Peptide YY (PYY) (3-36), porcine TFA
MoreAll Neuropeptide Y Receptor Isoforms
More
Biological Activity
Description
Chemical Information
-
Appearance Solid
-
Molecular Weight 4094.44
-
Formula C176H272N52O54.C2HF3O2
-
Color White to off-white
-
Sequence
Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr
-
Sequence Shortening
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
J Headache Pain
Neuropeptide Y in the medial habenula alleviates migraine-like behaviors through the Y1 receptor. [Abstract]2023 May 25;24(1):61. PMID: 37231359 -
J Pharm Biomed Anal
Analyzing proteolytic stability and metabolic hotspots of therapeutic peptides in two rodent pulmonary fluids. [Abstract]2023 Feb 5:224:115156. PMID: 36463768 -
J Pharm Biomed Anal
Automated high-throughput in vitro assays to identify metabolic hotspots and protease stability of structurally diverse, pharmacologically active peptides for inhalation. [Abstract]2022 Mar 20:211:114518. PMID: 35124452
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (24.42 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 100 mg/mL (24.42 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
In Vivo:
For the following dissolution methods, please prepare the working solution directly:
It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: PBS
Solubility: 50 mg/mL (12.21 mM); Clear solution; Need ultrasonic
Purity & Documentation
-
Data Sheet (268 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO / H2O | 1 mM | 0.2442 mL | 1.2212 mL | 2.4423 mL | 6.1058 mL |
| 5 mM | 0.0488 mL | 0.2442 mL | 0.4885 mL | 1.2212 mL | |
| 10 mM | 0.0244 mL | 0.1221 mL | 0.2442 mL | 0.6106 mL | |
| 15 mM | 0.0163 mL | 0.0814 mL | 0.1628 mL | 0.4071 mL | |
| 20 mM | 0.0122 mL | 0.0611 mL | 0.1221 mL | 0.3053 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Peptide YY (PYY) (3-36), porcine TFA Related Classifications
HY-P1021A Related Classifications
Powered by Bioz