Peptide YY (PYY) (3-36), porcine TFA

Name: Peptide YY (PYY) (3-36), porcine TFA
Brand: MedChemExpress
SKU: HY-P1021A
Rating: 5.0 (3 reviews)

Cat. No.: HY-P1021A Pureté: 99.97%: Fiche technique
COA

SDS
Instruction de manipulation
FAQs
Technical Support

Peptide YY (PYY) (3-36), porcine TFA is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Synthèse de peptides personnalisée

Peptide YY (PYY) (3-36), porcine TFA Chemical Structure

Size	Stock	Quantité
5 mg	En stock	Estimated Time of Arrival: December 31
10 mg	En stock	Estimated Time of Arrival: December 31
50 mg	Obtenir un devis
100 mg	Obtenir un devis

or Bulk Inquiry

* Veuillez sélectionner la quantité avant d'ajouter des articles.

This product is a controlled substance and not for sale in your territory.

Avis client

Based on 3 publication(s) in Google Scholar

Other Forms of Peptide YY (PYY) (3-36), porcine TFA:

Peptide YY (PYY) (3-36), porcine Obtenir un devis

3 Publications Citing Use of MCE Peptide YY (PYY) (3-36), porcine TFA

Recommandations en vedette

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Voir tous les produits spécifiques à Isoform Neuropeptide Y Receptor:

Voir toutes les isoformes

NPY Y₁ receptor NPY Y₂ receptor NPY Y₄ receptor NPY Y₅ receptor

Activité biologique
Pureté et documentation
Références
Avis client

Description

Peptide YY (PYY) (3-36), porcine TFA is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite^[1].

Masse moléculaire

4094.44

Formule

C₁₇₆H₂₇₂N₅₂O₅₄.C₂HF₃O₂

Appearance

Solid

Color

White to off-white

Sequence

Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr

Sequence Shortening

AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvant et solubilité

In Vitro:

DMSO : 100 mg/mL (24.42 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H₂O : 100 mg/mL (24.42 mM; Need ultrasonic)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2442 mL	1.2212 mL	2.4423 mL
5 mM	0.0488 mL	0.2442 mL	0.4885 mL
10 mM	0.0244 mL	0.1221 mL	0.2442 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Calculateur de molarité
Calculateur de dilution

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo:

For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

Protocol 1

Add each solvent one by one: PBS
Solubility: 50 mg/mL (12.21 mM); Clear solution; Need ultrasonic

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Pureté et documentation

Purity: 99.97%

Select Batch:

Fiche technique (268 KB) SDS (252 KB)

COA (240 KB) RP-HPLC (255 KB) LCMS (105 KB) Elemental Analysis Report (100 KB)

Instruction de manipulation (2659 KB)

Références

[1]. Addison ML, et al. A role for metalloendopeptidases in the breakdown of the gut hormone, PYY 3-36. Endocrinology. 2011 Dec;152(12):4630-40. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

DMSO / H₂O	1 mM	0.2442 mL	1.2212 mL	2.4423 mL	6.1058 mL
	5 mM	0.0488 mL	0.2442 mL	0.4885 mL	1.2212 mL
	10 mM	0.0244 mL	0.1221 mL	0.2442 mL	0.6106 mL
	15 mM	0.0163 mL	0.0814 mL	0.1628 mL	0.4071 mL
	20 mM	0.0122 mL	0.0611 mL	0.1221 mL	0.3053 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.