1. GPCR/G Protein
  2. Adenylate Cyclase PTHR
  3. pTH (1-37) (human)

PTH (1-37) human is an adenylate cyclase stimulator and a normocalcemic regulator. PTH (1-37) human participates in cAMP-dependent signal transduction to affect the proliferation of skeletal tissue cells and bone metabolism. PTH (1-37) human induces cyclic adenosine monophosphate responses in human primary osteoblast-like cells and is also widely used in osteoporosis-related research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

pTH (1-37) (human)

pTH (1-37) (human) Chemical Structure

CAS No. : 136799-54-7

Size Price Stock Quantity
100 μg In-stock
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 Customer Validation

Top Publications Citing Use of Products

View All PTHR Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

PTH (1-37) human is an adenylate cyclase stimulator and a normocalcemic regulator. PTH (1-37) human participates in cAMP-dependent signal transduction to affect the proliferation of skeletal tissue cells and bone metabolism. PTH (1-37) human induces cyclic adenosine monophosphate responses in human primary osteoblast-like cells and is also widely used in osteoporosis-related research[1][2].

In Vitro

pTH (1-37) (human) maintains a consistent secondary and tertiary structure in near physiological aqueous buffer solution that matches the structures of hPTH(1-34) and hPTH(1-39) under identical conditions[1].
pTH (1-37) (human) contains approximately 27% α-helical structure in near physiological aqueous buffer solution, matching the helix content of hPTH(1-34) and hPTH(1-39) under identical conditions[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4401.08

Formula

C195H316N58O54S2

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu

Sequence Shortening

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : ≥ 100 mg/mL (22.72 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : ≥ 50 mg/mL (11.36 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2272 mL 1.1361 mL 2.2722 mL
5 mM 0.0454 mL 0.2272 mL 0.4544 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.91%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O / DMSO 1 mM 0.2272 mL 1.1361 mL 2.2722 mL 5.6804 mL
5 mM 0.0454 mL 0.2272 mL 0.4544 mL 1.1361 mL
10 mM 0.0227 mL 0.1136 mL 0.2272 mL 0.5680 mL
DMSO 15 mM 0.0151 mL 0.0757 mL 0.1515 mL 0.3787 mL
20 mM 0.0114 mL 0.0568 mL 0.1136 mL 0.2840 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
pTH (1-37) (human)
Cat. No.:
HY-P4823
Quantity:
MCE Japan Authorized Agent: