ACVR2B Protein, Human/Cynomolgus (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B, Human/Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus/human-derived ACVR2B protein, expressed by HEK293, with C-His labeled tag.
- Species: Cynomolgus; Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B, Human/Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus/human-derived ACVR2B protein, expressed by HEK293, with C-His labeled tag.
Background
ACVR2B, a transmembrane serine/threonine kinase, forms an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B, or ACVR1c), playing a crucial role in transducing activin signals across the cell membrane and regulating various physiological and pathological processes. This includes influencing neuronal differentiation and survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. Activin, known to have a paracrine or autocrine role in ovarian follicular development, binds to the type-2 receptor at the plasma membrane, activating its serine-threonine kinase activity. This activated type-2 receptor then phosphorylates and activates the type-1 receptor, such as ACVR1B, leading to subsequent phosphorylation of the SMAD proteins SMAD2 and SMAD3. Once activated, SMAD2 and SMAD3, in association with the common partner SMAD4, translocate into the nucleus, where they mediate activin-induced transcription. The inhibitory SMAD7, recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, blocking the activin signal. Furthermore, the binding of inhibin-B to the receptor, facilitated by the IGSF1 inhibin coreceptor, acts as an antagonist to activin signal transduction.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized Human Latent Activin A, His Tag at 5 μg/mL (100 μL/well) can bind Biotinylated Human Activin RIIB Protein, His,Avi tag with the EC50 of 0.2-0.4 μg/mL.
Technical Parameters
-
Species Cynomolgus; Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q13705-1 (S19-T137)/XP_045242398.1 (S40-T158)
-
Gene ID93/102118668
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
ACVR2B; Serine/Threonine-Protein Kinase Receptor; Activin A Receptor Type 2B; Activin Receptor Type IIB; ActR-IIB; ACTR-IIB; Activin A Receptor, Type IIB; ACTRIIB; Activin Receptor Type-2B; HTX4
-
AA Sequence
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT
-
Predicted Molecular Mass
17.2 kDa
-
Molecular Weight
Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.
\
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)