ACVR2B Protein, Human/Cynomolgus (Biotinylated, HEK293, mFc)
ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B Protein, Human/Cynomolgus (Biotinylated, HEK293, mFc) is the recombinant human-derived ACVR2B protein, expressed by HEK293, with C-mFc labeled tag.
- Species: Human; Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B Protein, Human/Cynomolgus (Biotinylated, HEK293, mFc) is the recombinant human-derived ACVR2B protein, expressed by HEK293, with C-mFc labeled tag.
Background
ACVR2B, a transmembrane serine/threonine kinase, forms an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B, or ACVR1c), playing a crucial role in transducing activin signals across the cell membrane and regulating various physiological and pathological processes. This includes influencing neuronal differentiation and survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. Activin, known to have a paracrine or autocrine role in ovarian follicular development, binds to the type-2 receptor at the plasma membrane, activating its serine-threonine kinase activity. This activated type-2 receptor then phosphorylates and activates the type-1 receptor, such as ACVR1B, leading to subsequent phosphorylation of the SMAD proteins SMAD2 and SMAD3. Once activated, SMAD2 and SMAD3, in association with the common partner SMAD4, translocate into the nucleus, where they mediate activin-induced transcription. The inhibitory SMAD7, recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, blocking the activin signal. Furthermore, the binding of inhibin-B to the receptor, facilitated by the IGSF1 inhibin coreceptor, acts as an antagonist to activin signal transduction.
Technical Parameters
-
Species Human; Cynomolgus
-
Source HEK293
-
Tag C-mFc
-
Accession
Q13705-1 (S19-T137)/XP_045242398.1 (S40-T158)
-
Gene ID93/102118668
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
ACVR2B; Serine/Threonine-Protein Kinase Receptor; Activin A Receptor Type 2B; Activin Receptor Type IIB; ActR-IIB; ACTR-IIB; Activin A Receptor, Type IIB; ACTRIIB; Activin Receptor Type-2B; HTX4
-
AA Sequence
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT
-
Predicted Molecular Mass
39.3 kDa
-
Molecular Weight
Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)