ALK-7 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
ALK-7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ALK-7 protein, expressed by HEK293, with C-His tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ALK-7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ALK-7 protein, expressed by HEK293, with C-His tag.
Background
ALK-7 is a serine/threonine protein kinase that forms a receptor complex upon ligand binding. The receptor complex consists of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors, which then autophosphorylate, bind, and activate SMAD transcriptional regulators SMAD2 and SMAD3. It serves as a receptor for activin AB, activin B, and NODAL, playing roles in cell differentiation, growth arrest, and apoptosis.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Immobilized Cynomolgus ALK-7, His Tag at 0.5μg/mL (100μL/well) on the plate. Dose response curve for Anti-ALK-7 Antibody, hFc Tag with the EC50 of 3.1-4.6ng/mL determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5VZP2 (G25-E113)
-
Gene ID102131774
-
Molecular Construction
-
N-term
-
ALK-7 (G25-G113)
Accession # A0A2K5VZP2 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ACVR1C; Activin Receptor Type-1C; Activin A Receptor Type 1C; Activin Receptor Type IC; ALK7; ACTR-IC; ACVRLK7; ALK-7; Activin Receptor-Like Kinase 7; Uncharacterized Protein ACVR1C; Activin A Receptor, Type IC
-
AA Sequence
GLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
-
Predicted Molecular Mass
11.2 kDa
-
Molecular Weight
Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl pH 7.5, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
