ARL2BP Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (His) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (His) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-6*His labeled tag.

Background

The ARL2BP protein, in collaboration with ARL2, assumes a pivotal role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its involvement in cellular processes. Acting potentially as an effector of ARL2, ARL2BP is found in complexes with ARL2 and SLC25A6, as well as ARL2, ARL2BP, and SLC25A4. It interacts with key transcription factors, including STAT2, STAT3, and STAT4, with an enhanced interaction with STAT3 in the presence of ARL2. Notably, ARL2BP's association with GTP-bound ARL2 and ARL3, either as the ARL2-ARL2BP complex or ARL2BP alone, binds to SLC25A4, suggesting a role in protein targeting. Additionally, the interaction with ARL2 may be crucial for the specific targeting of ARL2BP to the cilia basal body. These intricate associations underscore ARL2BP's multifaceted involvement in cellular signaling and localization processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • ARL2BP (M1-H163)
      Accession # Q9Y2Y0-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    ARL2BP; Binder Of ARF2 Protein 1; Prev. RP66; Binder Of Arl2; BART1; ADP-Ribosylation Factor-Like 2 Binding Protein; BART; ADP-Ribosylation Factor Like 2 Binding Protein; ADP-Ribosylation Factor-Like Protein 2-Binding Protein; Arf-Like 2 Binding Protein B

  • AA Sequence

    MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00