CCL21C Protein, Mouse

Customer Review

Based on 1 Customer Validation

CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.

Background

CCL21C protein exerts dual functions by inhibiting hemopoiesis and inducing chemotaxis. In vitro, it demonstrates chemotactic activity specifically for thymocytes and activated T-cells, with no significant effect on B-cells, macrophages, or neutrophils. Additionally, CCL21C acts as a potent chemoattractant for mesangial cells and exhibits preferential activity towards naive T-cells. Implicating a role in lymphocyte homing to secondary lymphoid organs, CCL21C binds to both CCR7 and CXCR3 receptors. Furthermore, it interacts with PDPN, leading to the relocalization of PDPN to the basolateral membrane. These findings underscore the diverse regulatory functions of CCL21C in immune cell behavior and tissue-specific responses.

Verified Bioactivity

Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7 .The ED50 for this effect is 37.24 ng/mL, corresponding to a specific activity is 2.69×10^4 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7 .The ED50 for this effect is 37.24 ng/mL, corresponding to a specific activity is 2.69×10^4 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL21C (S24-G133)
      Accession # P86793
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Scya21c; Ccl21c; TCA4; Thymus-derived chemotactic agent 4; Small-inducible cytokine A21c; Beta-chemokine exodus-2; 6Ckine; C-C motif chemokine 21c

  • AA Sequence

    SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

  • Predicted Molecular Mass

    12.1 kDa

  • Molecular Weight

    Approximately 10-18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00