CCL21C Protein, Mouse
Based on 1 Customer Validation
CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.
Background
CCL21C protein exerts dual functions by inhibiting hemopoiesis and inducing chemotaxis. In vitro, it demonstrates chemotactic activity specifically for thymocytes and activated T-cells, with no significant effect on B-cells, macrophages, or neutrophils. Additionally, CCL21C acts as a potent chemoattractant for mesangial cells and exhibits preferential activity towards naive T-cells. Implicating a role in lymphocyte homing to secondary lymphoid organs, CCL21C binds to both CCR7 and CXCR3 receptors. Furthermore, it interacts with PDPN, leading to the relocalization of PDPN to the basolateral membrane. These findings underscore the diverse regulatory functions of CCL21C in immune cell behavior and tissue-specific responses.
Verified Bioactivity
Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7 .The ED50 for this effect is 37.24 ng/mL, corresponding to a specific activity is 2.69×10^4 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P86793 (S24-G133)
-
Gene ID100042493 [NCBI]
-
Molecular Construction
-
N-term
-
CCL21C (S24-G133)
Accession # P86793 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Scya21c; Ccl21c; TCA4; Thymus-derived chemotactic agent 4; Small-inducible cytokine A21c; Beta-chemokine exodus-2; 6Ckine; C-C motif chemokine 21c
-
AA Sequence
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
-
Predicted Molecular Mass
12.1 kDa
-
Molecular Weight
Approximately 10-18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)