1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC chemokine subfamily
  5. CCL24/Eotaxin-2 Protein, Human (HEK293, His)

CCL24/Eotaxin-2 Protein, Human (HEK293, His)

Cat. No.: HY-P7766
Handling Instructions

CCL24/Eotaxin-2 Protein, Human (HEK293, His) is an eotaxin family member that stimulates eosinophil chemotaxis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $105 In-stock
Estimated Time of Arrival: December 31
50 μg $314 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

CCL24/Eotaxin-2 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products

CCL24/Eotaxin-2 Protein, Human (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

O00175 (V27-C119)

Gene ID

6369

Synonyms
rHuCCL24, His; C-C motif chemokine 24 ; CCL24; Eosinophil chemotactic protein; Eotaxin-2; Myeloid progenitor inhibitory factor 2; Small-inducible cytokine A24; Ckb-6; MPIF-2; SCYA24
AA Sequence

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTCHHHHHH

Molecular Weight

Approximately 18 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The eotaxin family currently includes three members: eotaxin-1 (CCL11), eotaxin-2 (CCL24), and eotaxin-3 (CCL26). CCL24 (Chemokine c-c motif ligand 24, eotaxin-2) is a chemokine that promotes immune cell trafficking and activation as well as profibrotic activities through the CCR3 receptor (C-C chemokine receptor type 3). Both CCL24 and CCR3 is involved in lung and skin inflammation and fibrosis. CCL24 stimulates eosinophil chemotaxis, but CCL24 exerts actions on other innate immune cells as well. CCL24 is both important in the recruitment of basophils, T helper (Th) 2 CD4+ lymphocytes, and mast cells[1][2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL24/Eotaxin-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P7766
Quantity:
MCE Japan Authorized Agent: