1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands CD30L/CD153
  5. CD30 Ligand/TNFSF8 Protein, Human (HEK293, mFc)

CD30 Ligand/TNFSF8 Protein, Human (HEK293, mFc)

Cat. No.: HY-P78405
Handling Instructions Technical Support

CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division. As for CD30 ligand in human is a type II membrane-associated glycoprotein belonging to the tumor necrosis factor (TNF) family. CD30 Ligand/TNFSF8 Protein, Human (HEK293, mFc) is 172 amino acids in length (Q63-D234) and is expressed in the HEK293 cells with a N-terminal mFc-tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching[1]. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system[2]. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division[3]. As for CD30 ligand in human is a type II membrane-associated glycoprotein belonging to the tumor necrosis factor (TNF) family. CD30 Ligand/TNFSF8 Protein, Human (HEK293, mFc) is 172 amino acids in length (Q63-D234) and is expressed in the HEK293 cells with a N-terminal mFc-tag.

Background

CD30 Ligand (CD30L) is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching[1].
CD30L is a type II membrane-associated glycoprotein belonging to the tumor necrosis factor (TNF) family, structurally related to tumour necrosis superfamily members TNF alpha, TNF beta, and CD40[1][3].
CD30L enhances cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines to play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. CD30L also enhances release of cytokine IL-6, TNF, LT-a[2].
CD30L exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division regulation[3].
CD30L is mainly expressed on activated T cells, B cells, macrophages and DCs, while CD30/CD30L mainly expressed on the surface of activated CD4+ T cells in the lamina propria (LP), especially at the early stage of Th17 cell differentiation. CD30L deficiency could inhibit Th17 cell differentiation and production of IL-17A in the intestinal mucosa[4].
CD30L acts as a pro-inflammatory cytokines, is involved in the adaptive immune response in ulcerative colitis (UC), the level of which shows positive correlation with the severity of UC[5].

Species

Human

Source

HEK293

Tag

N-mFc

Accession

P32971 (Q63-D234)

Gene ID

944  [NCBI]

Molecular Construction
N-term
mFc
CD30L (Q63-D234)
Accession # P32971
C-term
Protein Length

Extracellular Domain

Synonyms
CD153; CD30 Ligand; CD30L; CD30-L; CD30LGMGC138144; TNFSF8; CD30LG
AA Sequence

QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Predicted Molecular Mass
46.2 kDa
분자량

Approximately 55-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD30 Ligand/TNFSF8 Protein, Human (HEK293, mFc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD30 Ligand/TNFSF8 Protein, Human (HEK293, mFc)
Cat. No.:
HY-P78405
수량:
MCE Japan Authorized Agent: