Copy Link Print Information

Fas Ligand Protein, Human (HEK293, N-His)

Customer Review

Based on 1 Customer Validation

Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells. However the membrane-bound isoform could be responsible for its inflammatory activity. Fas Ligand Protein, Human (HEK293, His) has a total length of 148 amino acids (P134-L281), is expressed in HEK392 cells with N-terminal 6*His-tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Fas Ligand Protein, Human (HEK293, N-His)
  • Experimental Validation Results for Fas Ligand Protein, Human (HEK293, N-His)
  • Fas Ligand Protein, Human (HEK293, N-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development[1]. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells[3]. However the membrane-bound isoform could be responsible for its inflammatory activity[4]. Fas Ligand Protein, Human (HEK293, His) has a total length of 148 amino acids (P134-L281), is expressed in HEK392 cells with N-terminal 6*His-tag.

Background

Fas Ligand (FasL; FASLG; CD95L), is a ligand for TNFRSF6/FAS belonging to the tumor necrosis factor (TNF). FasL is a type II transmembrane protein, riggering apoptosis of lymphocytes[1].
FasL is expressed on a variety of cell types, including T cells, natural killer (NK) cells, monocytes, neutrophils, breast epithelial cells, and vascular endothelial cells[3].
FasL exerts different biological activity by cleaved into 4 isoforms including membrane form, soluble form, ADAM10-processed FasL form (APL) and SPPL2A-processed FasL form (SPA). Among them, the membrane-bound form and a soluble form generated by proteolytic action of matrix metalloproteinases (MMP)[3].
FasL or soluble FasL binding to Fas results in receptor aggregation and in the interaction of a protein called Fas-associated death domain with the Fas cytoplasmic tail. The interaction triggers a cascade of intracellular events, including the activation of the IL-1-converting enzyme-like cysteine protease (caspase 8), that ultimately leads to nucleoprotein cleavage, DNA fragmentation, and cell apoptosis[6].
The loss of function due to mutations in murine FasL, murine Fas, human Fas, or human FasL leads to lymphoproliferation, lymphadenopathy, and autoimmune diseases[1][3].
Meanwhile, defective activation-induced cell death (AICD) results in spontaneous mutation of Fas and FasL genes in mice with lupus-like autoimmune disease[3].
Human Fas Ligand also involves in Jurkat cell apoptosis and binds TNFRSF6B/DcR3 to bolck apoptosis, which is a decoy receptor of apoptosis termination[3].
FasL is widely found in different animals, while the sequence in Human is different from Rat and Mouse with similarity of 77.26% and 78.06%, respectively.

In Vitro

Human soluble FasL (4000 units/mL; 18 hr) induces neutrophil infiltration[4].
Human membrane-bound FasL (4000 units/mL; 18 hr) is found to induce IL-1β release in plastic adherent macrophages separated from 4-day PEC instead of recombinant mouse soluble FasL (WX1)[4].
Soluble FasL (0.1-10 nM) of human induces chemotaxis of mouse neutrophils in vitro at concentrations incapable of inducing cell apoptosis.[6].

In Vivo

Purified human soluble FasL (0-10 ng; i.p.; single dose) does not show neutrophil chemotactic activity in vivo in ddY mice[4].
Expressing membrane-bound FasL (FFL, FDC2) but not soluble FasL (FFS) rejects tumor cells quickly than the control in wild-type mice[4].

Verified Bioactivity

Measured by its ability to induce apoptosis of Jurkat human acute T cell leukemia cells in the presence of 10 µg/mL of a cross-linking antibody His-Tag Monoclonal antibody. The ED50 for this effect is 0.3-1.5 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce apoptosis of Jurkat human acute T cell leukemia cells in the presence of 10 µg/mL of a cross-linking antibody His-Tag Monoclonal antibody. The ED50 for this effect is 1.35 ng/mL, corresponding to a specific activity is 7.407×105 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-6*His
  • Accession

    P48023-1 (P134-L281)

  • Gene ID
    356
  • Molecular Construction
    • N-term
    • 6*His
    • Fas Ligand (P134-L281)
      Accession # P48023
    • C-term
  • Protein Length

    Full Length of FASLG, soluble form

  • Synonyms

    FASLG; TNLG1A; Prev. APT1LG1; CD95L; Prev. TNFSF6; APTL; FasL; Tumor Necrosis Factor (Ligand) Superfamily, Member 6; Tumor Necrosis Factor Ligand Superfamily Member 6; Mutant Tumor Necrosis Factor Family Member 6; Fas Antigen Ligand; Apoptosis (APO-1) Antigen Ligand 1; CD95 Ligand; Tumor Necrosis Factor Ligand 1A; CD178; CD178 Antigen; Fas Ligand (TNF Superfamily, Member 6); ALPS1B; Apoptosis Antigen Ligand; FASL; Fas Ligand; CD95-L

  • AA Sequence

    PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

  • Predicted Molecular Mass

    17.71 kDa

  • Molecular Weight

    Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce apoptosis of Jurkat human acute T cell leukemia cells in the presence of 10 µg/mL of a cross-linking antibody His-Tag Monoclonal antibody. The ED50 for this effect is 1.35 ng/mL, corresponding to a specific activity is 7.407×105 units/mg.

  • Fas Ligand Protein, Human (HEK293, N-His) Product Image
    1/16
  • Experimental Validation Results for Fas Ligand Protein, Human (HEK293, N-His)
  • Experimental Validation Results for Fas Ligand Protein, Human (HEK293, N-His)
  • Fas Ligand Protein, Human (HEK293, N-His) Product Image