FGF-1 Protein, Human (Biotinylated, His, Avi)

FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. FGF-1 Protein, Human (Biotinylated, His, Avi) is the recombinant human-derived FGF-1 protein, expressed by E. coli, with N-His and N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. FGF-1 Protein, Human (Biotinylated, His, Avi) is the recombinant human-derived FGF-1 protein, expressed by E. coli, with N-His and N-Avi labeled tag.

Background

FGF-1 Protein assumes a pivotal role in intricately regulating cell survival, division, angiogenesis, differentiation, and migration. Functioning as a potent mitogen in vitro, it acts as a ligand for FGFR1 and integrins. Binding to FGFR1, particularly in the presence of heparin, leads to FGFR1 dimerization and activation through sequential autophosphorylation on tyrosine residues. This activation serves as docking sites for interacting proteins, initiating several signaling cascades. Furthermore, FGF-1 Protein binds to integrin ITGAV:ITGB3, forming a ternary complex with integrin and FGFR1, crucial for FGF1 signaling. Inducing the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, it demonstrates its involvement in diverse cellular processes. Additionally, FGF-1 Protein's ability to induce angiogenesis further underscores its multifaceted role. Interactions with FGFRs, integrins, and various proteins within complex networks highlight its intricate participation in cellular signaling pathways, emphasizing its significance in cell physiology.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-Avi;N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • Avi
    • FGF-1 (F16-D155)
      Accession # P05230-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    FGF1; Endothelial Cell Growth Factor, Alpha; Prev. FGFA; Fibroblast Growth Factor 1 (Acidic); Heparin-Binding Growth Factor 1; Acidic Fibroblast Growth Factor; AFGF; HBGF-1; ECGF; FGF-1; ECGF-Beta; Beta-Endothelial Cell Growth Factor; FGF-Alpha; Endotheli

  • AA Sequence

    FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

  • Predicted Molecular Mass

    18.7 kDa

  • Molecular Weight

    Approximately 20-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00