FGFR-2 Protein, Human (Active, E565G, sf9)
The FGFR-2 α IIIc protein is a tyrosine protein kinase receptor for fibroblast growth factor and is critical for embryonic development, regulating proliferation, differentiation, and apoptosis. Its importance is evident in embryonic patterning, trophoblast function, limb bud development, lung morphogenesis, osteogenesis, and skin development. FGFR-2, Human (Active, E565G, sf9) is the recombinant human-derived FGFR-2 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The FGFR-2 α IIIc protein is a tyrosine protein kinase receptor for fibroblast growth factor and is critical for embryonic development, regulating proliferation, differentiation, and apoptosis. Its importance is evident in embryonic patterning, trophoblast function, limb bud development, lung morphogenesis, osteogenesis, and skin development. FGFR-2, Human (Active, E565G, sf9) is the recombinant human-derived FGFR-2 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
FGFR-2 alpha IIIc protein, a tyrosine-protein kinase, serves as a cell-surface receptor for fibroblast growth factors and holds a pivotal role in regulating cell proliferation, differentiation, migration, and apoptosis, as well as embryonic development. Its indispensability is evident in normal embryonic patterning, trophoblast function, limb bud development, lung morphogenesis, osteogenesis, and skin development. Moreover, FGFR-2 alpha IIIc plays a crucial role in osteoblast differentiation, proliferation, and apoptosis, contributing significantly to normal skeleton development. While promoting cell proliferation in keratinocytes and immature osteoblasts, it fosters apoptosis in differentiated osteoblasts. Upon ligand binding, FGFR-2 alpha IIIc activates multiple signaling cascades, including the phosphorylation of PLCG1, FRS2, and PAK4. Activation of PLCG1 triggers the production of cellular signaling molecules such as diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 leads to the recruitment of GRB2, GAB1, PIK3R1, and SOS1, mediating the activation of RAS, MAPK1/ERK2, MAPK3/ERK1, the MAP kinase signaling pathway, and the AKT1 signaling pathway. To regulate FGFR2 signaling, the protein undergoes down-regulation through ubiquitination, internalization, and degradation. Mutations resulting in constitutive kinase activation or impairing normal FGFR2 maturation, internalization, and degradation lead to aberrant signaling. Additionally, overexpressed FGFR2 promotes the activation of STAT1.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag Tag Free
-
Accession
P21802-1 (D456-E768, E565G)
-
Gene ID2263
-
Molecular Construction
-
N-term
-
(D456-E768, E565G)
Accession # P21802-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FGFR2; Protein Tyrosine Kinase, Receptor Like 14; Prev. KGFR; Fibroblast Growth Factor Receptor; Prev. BEK; Receptor Protein-Tyrosine Kinase; Prev. CFD1; Craniofacial Dysostosis 1; Prev. JWS; Alternative Protein FGFR2; Keratinocyte Growth Factor Receptor;
-
AA Sequence
DTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVGYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEE
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)