FGFR-2 Protein, Human (Active, K659N, sf9, His-Strep, Avi)

The FGFR-2 α IIIc protein is a tyrosine protein kinase receptor for fibroblast growth factor and is critical for embryonic development, regulating proliferation, differentiation, and apoptosis. Its importance is evident in embryonic patterning, trophoblast function, limb bud development, lung morphogenesis, osteogenesis, and skin development. FGFR-2, Human (Active, K659N, sf9, His-Strep, Avi) is the recombinant human-derived FGFR-2 protein, expressed by sf9 insect cells, with N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

The FGFR-2 α IIIc protein is a tyrosine protein kinase receptor for fibroblast growth factor and is critical for embryonic development, regulating proliferation, differentiation, and apoptosis. Its importance is evident in embryonic patterning, trophoblast function, limb bud development, lung morphogenesis, osteogenesis, and skin development. FGFR-2, Human (Active, K659N, sf9, His-Strep, Avi) is the recombinant human-derived FGFR-2 protein, expressed by sf9 insect cells, with N-Avi labeled tag.

Background

FGFR-2 alpha IIIc protein, a tyrosine-protein kinase, serves as a cell-surface receptor for fibroblast growth factors and holds a pivotal role in regulating cell proliferation, differentiation, migration, and apoptosis, as well as embryonic development. Its indispensability is evident in normal embryonic patterning, trophoblast function, limb bud development, lung morphogenesis, osteogenesis, and skin development. Moreover, FGFR-2 alpha IIIc plays a crucial role in osteoblast differentiation, proliferation, and apoptosis, contributing significantly to normal skeleton development. While promoting cell proliferation in keratinocytes and immature osteoblasts, it fosters apoptosis in differentiated osteoblasts. Upon ligand binding, FGFR-2 alpha IIIc activates multiple signaling cascades, including the phosphorylation of PLCG1, FRS2, and PAK4. Activation of PLCG1 triggers the production of cellular signaling molecules such as diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 leads to the recruitment of GRB2, GAB1, PIK3R1, and SOS1, mediating the activation of RAS, MAPK1/ERK2, MAPK3/ERK1, the MAP kinase signaling pathway, and the AKT1 signaling pathway. To regulate FGFR2 signaling, the protein undergoes down-regulation through ubiquitination, internalization, and degradation. Mutations resulting in constitutive kinase activation or impairing normal FGFR2 maturation, internalization, and degradation lead to aberrant signaling. Additionally, overexpressed FGFR2 promotes the activation of STAT1.

Technical Parameters

  • Species Human
  • Source sf9 insect cells
  • Tag N-Avi;N-Strep;N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-Strep-Avi
    • (D456-E768, K659N)
      Accession # P21802-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FGFR2; Protein Tyrosine Kinase, Receptor Like 14; Prev. KGFR; Fibroblast Growth Factor Receptor; Prev. BEK; Receptor Protein-Tyrosine Kinase; Prev. CFD1; Craniofacial Dysostosis 1; Prev. JWS; Alternative Protein FGFR2; Keratinocyte Growth Factor Receptor;

  • AA Sequence

    DTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKNTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEE

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipped with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00