1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CX3C chemokine subfamily
  5. Fractalkine/CX3CL1 Protein, Human

Fractalkine/CX3CL1 Protein, Human

Cat. No.: HY-P7180
Handling Instructions

Fractalkine/CX3CL1 Protein, Human is found to be associated with inflammatory diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV).

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Fractalkine/CX3CL1 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P78423 (Q25-G100)

Gene ID

6376

Synonyms
rHuFractalkine/CX3CL1; Neurotactin; SCYD1; NTT
AA Sequence

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Molecular Weight

Approximately 8.6 kDa

Biological Activity
Full biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 5.0-10 ng/ml.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 50 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Fractalkine/CX3CL1 exists in two forms: as a membrane-anchored or as a shed 80-95K glycoprotein. Fractalkine/CX3CL1 is expressed in monocytes during inflammatory conditions. Fractalkine/CX3CL1 is also expressed in macrophages, fibroblasts, endothelial, and dendritic cells in rheumatoid arthritis (RA) synovial tissue. CX3CL1 is associated with the development of different diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV), Sjögren’s syndrome (SS), systemic lupus erythematosus (SLE), scleroderma, multiple sclerosis, and atherosclerosis[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fractalkine/CX3CL1 Protein, Human
Cat. No.:
HY-P7180
Quantity:
MCE Japan Authorized Agent: