Fractalkine/CX3CL1 Protein, Human

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

Fractalkine/CX3CL1 Protein, Human is found to be associated with inflammatory diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Fractalkine/CX3CL1 Protein, Human is found to be associated with inflammatory diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV).

Background

Fractalkine/CX3CL1 exists in two forms: as a membrane-anchored or as a shed 80-95K glycoprotein. Fractalkine/CX3CL1 is expressed in monocytes during inflammatory conditions. Fractalkine/CX3CL1 is also expressed in macrophages, fibroblasts, endothelial, and dendritic cells in rheumatoid arthritis (RA) synovial tissue. CX3CL1 is associated with the development of different diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV), Sjögren’s syndrome (SS), systemic lupus erythematosus (SLE), scleroderma, multiple sclerosis, and atherosclerosis[1].

Verified Bioactivity

1.Full biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 5.0-10 ng/mL.
2.Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 7.841 ng/mL, corresponding to a specific activity is 1.275×105 U/mg.
3.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CX3CR1. The ED50 for this effect is 1.0-10.0 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 7.841 ng/mL, corresponding to a specific activity is 1.275×105 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Fractalkine (Q25-G100)
      Accession # P78423
    • C-term
  • Protein Length

    Full Length of Chemokine and involved in interaction with ITGAV:ITGB3 and ITGA4:ITGB1 Region

  • Synonyms

    CX3CL1; NTN; Prev. SCYD1; CX3C Membrane-Anchored Chemokine; Chemokine (C-X3-C Motif) Ligand 1; Small-Inducible Cytokine D1; Fractalkine; C-X3-C Motif Chemokine 1; Neurotactin; NTT; C3Xkine; Small Inducible Cytokine Subfamily D (Cys-X3-Cys), Member-1; ABCD

  • AA Sequence

    QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

  • Predicted Molecular Mass

    8.6 kDa

  • Molecular Weight

    Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 50 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00