Fractalkine/CX3CL1 Protein, Canine (HEK293, His)

The Fractalkine/CX3CL1 protein is a member of the intercrine beta family and plays a key role in chemokines that are critical for intercellular communication and immune responses. In this family, Fractalkine/CX3CL1 may significantly regulate inflammatory processes and cellular interactions. Fractalkine/CX3CL1 Protein, Canine (HEK293, His) is the recombinant canine-derived Fractalkine/CX3CL1 protein, expressed by HEK293 , with C-His labeled tag.

Fractalkine/CX3CL1 protein is a member of the intercrine beta (chemokine CC) family, positioning it within a category of chemokines with pivotal roles in intercellular communication and immune responses. As part of the intercrine beta family, Fractalkine/CX3CL1 likely plays a significant role in modulating inflammatory processes and cellular interactions. Further exploration is essential to uncover the specific functions and implications of Fractalkine/CX3CL1 within the broader framework of the chemokine CC family, shedding light on its importance in mediating immune responses and contributing to the intricate network of intercellular signaling.

Canine

HEK293

C-His

E2RTH0 (Q25-G100)

487265  [NCBI]

Partial

QHLGVKKCNVTCHKMTSEIPVALLVHYQRNQESCGKPAIILKTKQNRIFCADPKERWVQKAIAHLEHQIAVTIRNG

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.