Fractalkine/CX3CL1 Protein, Canine (HEK293, His)
The Fractalkine/CX3CL1 protein is a member of the intercrine beta family and plays a key role in chemokines that are critical for intercellular communication and immune responses. In this family, Fractalkine/CX3CL1 may significantly regulate inflammatory processes and cellular interactions. Fractalkine/CX3CL1 Protein, Canine (HEK293, His) is the recombinant canine-derived Fractalkine/CX3CL1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Fractalkine/CX3CL1 protein is a member of the intercrine beta family and plays a key role in chemokines that are critical for intercellular communication and immune responses. In this family, Fractalkine/CX3CL1 may significantly regulate inflammatory processes and cellular interactions. Fractalkine/CX3CL1 Protein, Canine (HEK293, His) is the recombinant canine-derived Fractalkine/CX3CL1 protein, expressed by HEK293 , with C-His labeled tag.
Background
Fractalkine/CX3CL1 protein is a member of the intercrine beta (chemokine CC) family, positioning it within a category of chemokines with pivotal roles in intercellular communication and immune responses. As part of the intercrine beta family, Fractalkine/CX3CL1 likely plays a significant role in modulating inflammatory processes and cellular interactions. Further exploration is essential to uncover the specific functions and implications of Fractalkine/CX3CL1 within the broader framework of the chemokine CC family, shedding light on its importance in mediating immune responses and contributing to the intricate network of intercellular signaling.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-His
-
Accession
E2RTH0 (Q25-G100)
-
Molecular Construction
-
N-term
-
Fractalkine (Q25-G100)
Accession # E2RTH0 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CX3CL1; NTN; Prev. SCYD1; CX3C Membrane-Anchored Chemokine; Chemokine (C-X3-C Motif) Ligand 1; Small-Inducible Cytokine D1; Fractalkine; C-X3-C Motif Chemokine 1; Neurotactin; NTT; C3Xkine; Small Inducible Cytokine Subfamily D (Cys-X3-Cys), Member-1; ABCD
-
AA Sequence
QHLGVKKCNVTCHKMTSEIPVALLVHYQRNQESCGKPAIILKTKQNRIFCADPKERWVQKAIAHLEHQIAVTIRNG
-
Predicted Molecular Mass
38.9 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
