1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled
  5. Frizzled-5
  6. Frizzled-5 Protein, Human (HEK293, His)

Frizzled-5 protein is a receptor for Wnt proteins (WNT2, WNT10B, WNT5A), which can activate WNT7A and promote the formation of synapses in neurons. It participates in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. Frizzled-5 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-5 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Frizzled-5 protein is a receptor for Wnt proteins (WNT2, WNT10B, WNT5A), which can activate WNT7A and promote the formation of synapses in neurons. It participates in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. Frizzled-5 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-5 protein, expressed by HEK293 , with C-His labeled tag.

Background

Frizzled-5 Protein functions as a receptor for Wnt proteins, including WNT2, WNT10B, and WNT5A, although it does not activate WNT2B or WNT4 in vitro, and the in vivo context may vary due to potential differences in coexpression. In neurons, the activation of WNT7A by Frizzled-5 promotes synapse formation. It actively participates in the canonical Wnt/beta-catenin signaling pathway, leading to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. Frizzled-5 may also engage a secondary signaling pathway involving PKC and calcium fluxes, the integration of which with the canonical pathway remains unclear, given PKC's apparent requirement for Wnt-mediated inactivation of GSK-3 kinase. This versatile receptor likely plays a role in transduction and intercellular transmission of polarity information during tissue morphogenesis and in differentiated tissues. Additionally, Frizzled-5 is implicated in yolk sac angiogenesis and placental vascularization, and its homodimerization is promoted by the binding of unsaturated fatty acid molecules via the FZ domain. Notably, Frizzled-5 interacts with WNT2B, WNT7A, and GOPC, contributing to its diverse range of cellular functions.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q13467 (A27-P167)

Gene ID
Molecular Construction
N-term
Frizzled-5 (A27-P167)
Accession # Q13467
His
C-term
Protein Length

Partial

Synonyms
C2orf31; Frizzled homolog 5 (Drosophila); Frizzled-5; FZ-5; FZD5
AA Sequence

ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKP

Molecular Weight

25-30 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Frizzled-5 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Frizzled-5 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-5 Protein, Human (HEK293, His)
Cat. No.:
HY-P74138
Quantity:
MCE Japan Authorized Agent: